KEGG   Bacillus subtilis subsp. subtilis 168: BSU18669Help
Entry
BSU18669          CDS       T00010                                 

Gene name
yozS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 DUF4257
Motif
Other DBs
NCBI-GeneID: 8302957
NCBI-ProteinID: YP_003097734
UniProt: C0H420
Position
complement(2037063..2037368)
Genome map
AA seq 101 aa AA seqDB search
MKALIFLSSLTAIGSSILGRWLGMLDDSYAVGDAWFIGVLAGLISLLILIDSQTMTKNYI
VSLSTILGILGVGFIYFPAAFINILLSITLDKQKKEDLHVR
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactcatatttttatccagtttgactgccattgggagctctatattggggcga
tggttagggatgctggatgattcttatgctgttggcgatgcttggtttataggtgtttta
gctggattgatttcacttctaatattgattgacagtcaaacgatgacaaagaattacata
gtaagtttaagtacgatactaggcattcttggagtgggatttatatattttccagctgca
ttcatcaacatattattaagtattacactggataaacaaaagaaagaagaccttcatgta
agatga

DBGET integrated database retrieval system