KEGG   Bacillus subtilis subsp. subtilis 168: BSU18680
Entry
BSU18680          CDS       T00010                                 

Gene name
yoaO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4944 Baculo_11_kDa DUF3139 EphA2_TM
Other DBs
NCBI-GeneID: 940005
NCBI-ProteinID: NP_389749
Pasteur: BG13485
BSORF: BG13485
UniProt: O34985
Position
complement(2038902..2039390)
AA seq 162 aa
MRKKNNIKKWLLIIAGFLIICIITLFVMVSGNKVKYEGSGKSGLWMSNLEKSDKTSIGPN
YFLNLYWQGSKKEEKWTVVERITLYVDGEKYQDDNVDEYDLSEYTGDEMPGGGRMEDHIS
TFDYMPEDEVIGHDVLVKVEWRTGQKKQTEAIKLHKKPWYKK
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaaaaaagaacaatattaagaaatggctattgatcattgctggattcttgatcatc
tgcatcatcacattatttgtaatggtgtcagggaacaaagtgaaatatgagggcagcggg
aaaagcggactgtggatgtctaaccttgaaaaatcagacaaaacttcaattggacccaat
tattttctaaatctatattggcaggggagtaagaaggaagaaaagtggactgttgttgaa
agaattactctgtatgtagatggcgaaaagtatcaagatgataacgtagatgagtacgac
ttatcggagtacacaggtgatgaaatgccgggtgggggacgcatggaggaccatatttcc
acctttgattatatgcctgaagatgaagtgataggtcatgatgtattagtaaaagtggag
tggaggacaggccagaaaaaacagacagaagcaatcaaattacataagaagccatggtat
aaaaaatag

DBGET integrated database retrieval system