KEGG   Bacillus subtilis subsp. subtilis 168: BSU18690Help
Entry
BSU18690          CDS       T00010                                 

Gene name
yoaP
Definition
(RefSeq) N-acetyltransferase YoaP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YoaP Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_13 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 939512
NCBI-ProteinID: NP_389750
Pasteur: BG13486
BSORF: BG13486
UniProt: O34983
Position
complement(2039610..2040365)
Genome map
AA seq 251 aa AA seqDB search
MCYIEITKDNIEDNHICCALSTKQYEHAVNEKKRWLKARMDEGLVFYRLHERAKVFIEYL
PANEAWVPINAPNFMYINCLWVSGRYKNNGHAKRLLDKCIADAKACGMDGIIHIAGKKKL
PYLSDKHFFEHMGFTLQDEAAPYFQLMALTWNGLADSPAFKSQVKSDSINEKGITIYYTA
QCPFAVGMINDLRELTEKKGVQFQSIQLSSKEEAQKSPAIWTTFSVFFDGRFVTHEIMSI
NKFEKLLNTLA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtgctacattgaaatcacaaaggacaatattgaagacaatcatatttgctgtgcatta
agcacgaaacaatatgagcatgcagttaatgaaaagaagagatggctcaaagctcgaatg
gatgaaggattggtgttctatcgcttacatgaacgggcaaaagtctttattgaataccta
cctgcgaatgaggcatgggtgcctatcaatgcgcctaattttatgtacattaattgtctg
tgggtgtctggcagatataaaaataacggtcatgcgaaacgattgttggacaaatgtata
gcagatgcgaaagcgtgcggcatggatggcattatccatatcgcaggcaagaaaaaactg
ccctatttaagtgataagcatttctttgagcatatggggtttactctacaagatgaagct
gccccttattttcaattaatggctttgacttggaatggccttgcagattctcctgcattt
aagagccaggtgaaaagtgattctatcaatgaaaaggggattacgatatactatacagct
cagtgtccgtttgcagtgggcatgataaatgatttgcgggaattgactgaaaagaaaggg
gttcaatttcagtcaattcagttatcatcgaaagaagaggcacaaaagtcaccagctatt
tggacaacttttagcgttttttttgatgggagatttgtgactcacgagatcatgagtata
aataaatttgaaaagttacttaatacactagcttga

DBGET integrated database retrieval system