KEGG   Bacillus subtilis subsp. subtilis 168: BSU18700Help
Entry
BSU18700          CDS       T00010                                 

Gene name
yoaQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_rich_CPCC
Motif
Other DBs
NCBI-GeneID: 940010
NCBI-ProteinID: NP_389751
Pasteur: BG13487
BSORF: BG13487
UniProt: O31831
Position
2040673..2041029
Genome map
AA seq 118 aa AA seqDB search
MVEKCYSCLICGYKGLIQNPLYKGEYQKTFDICPCCGFEFGYSEDHDVRLGFIVTPDHLI
EAAFQLYRKQWLESGMVIAHPEDIPEELKNGNCLKFEVLLKQLKKLNLDIENFEISGF
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
ttggtggaaaaatgttattcttgtttaatttgcggatacaaaggattaattcaaaatcct
ttgtataaaggcgagtatcaaaaaacgtttgacatttgtccatgttgcggttttgaattt
ggctacagtgaggatcatgatgtgaggttaggttttattgtaactcctgatcatttaatt
gaggctgcatttcaattgtatcgcaaacaatggcttgagagcgggatggtaattgctcat
ccggaagatattccagaagaattgaaaaatggcaattgcttaaaatttgaagttttgttg
aaacaattgaaaaaactaaatcttgacatagaaaattttgaaattagcggtttttaa

DBGET integrated database retrieval system