KEGG   Bacillus subtilis subsp. subtilis 168: BSU18709Help
Entry
BSU18709          CDS       T00010                                 

Gene name
yozT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8303003
NCBI-ProteinID: YP_003097735
UniProt: C0H421
Position
complement(2040988..2041227)
Genome map
AA seq 79 aa AA seqDB search
MTVINDYREEPEEAFWILYPMGVKCLSMITKSLLNTNRDFVTDCAFQLNILLIMTVKPKQ
VQPVSSLKTANFKIFYVKI
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtgattaatgactatagagaagaaccagaggaggccttttggatactttatccg
atgggagtgaaatgtttgtcgatgatcacaaagtctttattgaatacgaatagagacttt
gtgactgattgcgcatttcaacttaacattttactgataatgacagtgaaacctaaacaa
gtgcaacctgtttcatcattaaaaaccgctaatttcaaaattttctatgtcaagatttag

DBGET integrated database retrieval system