KEGG   Bacillus subtilis subsp. subtilis 168: BSU18710
Entry
BSU18710          CDS       T00010                                 

Gene name
yozF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4352
Other DBs
NCBI-GeneID: 939598
NCBI-ProteinID: NP_389752
Pasteur: BG13753
BSORF: BG13753
UniProt: O31832
Position
complement(2041330..2041827)
AA seq 165 aa
MKRVLFSVIVFTAVGFTFCQSKAHALTFTVLPITQKTDQWSVKVSEAKNVKEFTRPHKGE
YQVYSLEVKNIGEKAATVDVQLYRNDPNSITRFSLFGCPDENCVKPKEDSKMLAESLNDG
SPLKFNHFMLADKASELEVVIIWTQKGQEGRNLKQTFKFTEDGVN
NT seq 498 nt   +upstreamnt  +downstreamnt
gtgaaaagggtattattttctgtaattgtttttacagcagttggatttacgttttgccaa
tcaaaagcgcatgccctgacttttacggtgttgcctattacacaaaaaacagaccagtgg
tcagtaaaagtaagtgaagcaaaaaatgtaaaggaatttacgagacctcataaaggagaa
tatcaagtatattccttggaagtcaaaaatataggggaaaaagcagctacagtggatgtg
caattgtatagaaatgaccctaattcaatcacaaggttttcgctttttggatgtcccgat
gaaaattgtgtcaaaccaaaagaagattctaaaatgttagctgaaagtttaaatgatggc
tcaccgctgaagttcaatcattttatgctggcagataaggcctctgaattagaggttgtt
ataatttggacacagaaggggcaagaaggacgcaatttaaaacagacctttaaattcact
gaagatggcgttaattag

DBGET integrated database retrieval system