KEGG   Bacillus subtilis subsp. subtilis 168: BSU18720
Entry
BSU18720          CDS       T00010                                 

Gene name
yoaR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: VanW PG_binding_4
Other DBs
NCBI-GeneID: 939962
NCBI-ProteinID: NP_389753
Pasteur: BG13488
BSORF: BG13488
UniProt: O34611
Position
complement(2041928..2042839)
AA seq 303 aa
MIQILITGLFLLAQPSEPQDSLTVTQQGRTIATVNREDFTMPLPGTPMVDYEKYSKFIKQ
LDQKVYREPINAVLNDHGSIVPGRVGYKLYQQAFMEKFYAYFYGQGPSKIEVPEMNIYPK
VDSELLAHISTQQLGQYVTYFNSSNKSRSHNISLSAKAIDNHVVFPNETFSFNQVVGMRT
RNKGYKSAPIIVKGELSEGVGGGICQVSSTLFNAVDRAGLQIVQRYSHTRSVPYVPPGRD
ATVSWGGPDFRFQNQYNQPILIRAKRYGGSMIITLYSSDVINSRLRKIPKAPSRIPKEIN
AEQ
NT seq 912 nt   +upstreamnt  +downstreamnt
atgatacaaattttgatcactggtctttttttattggctcagccgagtgagccgcaggac
agtttaacggtcacacagcaaggacggacgattgccactgttaaccgtgaagactttaca
atgcctcttcccggcactccaatggttgactatgaaaaatacagtaaattcatcaaacag
cttgatcagaaagtgtaccgtgagccgataaatgctgtccttaacgatcatggaagcatc
gtcccgggcagggttggctacaaactgtatcaacaggcgtttatggaaaagttttatgcg
tatttttatgggcaaggtccctccaagatagaagtgccggaaatgaacatttatccgaaa
gttgacagcgagctgctagctcacatcagtacgcagcagcttggtcagtacgtgacgtat
tttaactcaagcaataaaagccgttcacacaatatttctctttctgcaaaagcaatcgac
aatcacgttgttttccctaatgagacgttttcgtttaaccaagttgtgggaatgagaact
cggaacaaaggatataaaagtgcacccattattgtaaaaggggagttgtctgaaggtgta
ggaggaggaatttgtcaggtgtcctcaactctatttaatgcagtagatcgtgcaggactg
cagatcgttcagcgctattctcatactagaagtgtaccatatgtaccgcccggacgggat
gcgacggtaagctggggaggtcctgactttcgctttcaaaaccaatataaccaaccaatc
ttaattcgggcaaaaaggtatgggggaagtatgattattacgctatactcttctgatgtg
attaacagcagattgagaaaaatccccaaagctccttctcggataccgaaagaaataaat
gcagagcagtaa

DBGET integrated database retrieval system