KEGG   Bacillus subtilis subsp. subtilis 168: BSU18730
Entry
BSU18730          CDS       T00010                                 

Gene name
yoaS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2975 CHB_HEX
Other DBs
NCBI-GeneID: 939982
NCBI-ProteinID: NP_389754
Pasteur: BG13489
BSORF: BG13489
UniProt: O31833
Position
2043186..2043668
AA seq 160 aa
MNRMSTIFLKIALVLIGIPILALCIFLVPKVANYSAELFPNIAYIKYLVFIYLYVTAIPF
YFALYQAFKLLSYIDKNKAFSGLSVRALKNIKYCAVTISIFYAAGMPVFYLMAEIDDAPG
IIVIGLVIIFASMVIAVFAAVLQKLLKEAIDIKSENDLTV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaatcgaatgtcgacaatttttttaaagatagctttggttcttattggaattccaatt
cttgctttatgcatttttttagtgcctaaggtagccaactattcagcagaattatttcca
aatatcgcttatataaaatatctcgttttcatctatttgtatgtaacggcgatacctttt
tactttgctctttatcaagcgttcaaacttttaagctatattgacaaaaacaaagctttc
tcgggtttgtctgtaagagctttgaagaatataaaatattgcgcagtcactatcagtatc
ttttacgcagcaggcatgcctgtcttttatctgatggccgagatagacgacgccccgggt
atcattgtgatcggattggttattatttttgcttcaatggtgattgcggtctttgctgct
gttcttcaaaaactgttaaaagaagcgattgatataaaatcagaaaatgacttaacggtc
tga

DBGET integrated database retrieval system