KEGG   Bacillus subtilis subsp. subtilis 168: BSU18750Help
Entry
BSU18750          CDS       T00010                                 

Gene name
yoaT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF817
Motif
Other DBs
NCBI-GeneID: 940132
NCBI-ProteinID: NP_389756
Pasteur: BG13490
BSORF: BG13490
UniProt: O34535
Position
2044038..2044832
Genome map
AA seq 264 aa AA seqDB search
MRAIKQIVHFGWEQALSCLFPAVIFASLAITQIIPLPFLPRYDWLLIICVLMQLWMVRSG
LETRDELKVITLFHLIGLALELFKVHMGSWSYPEEGYSKIFGVPLYSGFMYASVASYLCQ
AWRRLKVELVKWPSFFAVVPLAAAIYLNFFTHHFSIDIRWWLSGLVIIVFWQTWVTYEVN
GARYRMPLALSFILIGFFIWIAENIATFFGAWKYPNQIDTWSLVHLGKVSSWLLLVIVSF
LIVASLKQVKEQSPTKAEMDESFS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagagccataaaacaaatcgtccattttggctgggaacaagccctttcatgtttgttt
cctgccgttatttttgcctctttggctattacgcaaatcatcccactgcccttcttgccg
cggtatgactggctgctcattatctgcgttctcatgcaattgtggatggtgcgttccggt
cttgagacacgggatgaattaaaagtgatcacattattccaccttattgggcttgctctg
gaactttttaaagtccatatgggctcctggtcttatccagaagaaggatactccaaaata
tttggagtacctttgtatagcggctttatgtacgcaagtgtagccagttatttgtgccag
gcatggagaaggcttaaggttgaactggttaagtggccgtctttttttgcagttgttccg
cttgccgcagcgatttatttgaattttttcacccaccatttttctatagacattcgatgg
tggttatcagggcttgtcatcattgtcttttggcaaacatgggttacatacgaggtgaat
ggagctcgttaccgtatgccgctcgcactttcttttatactcatcggattttttatatgg
atagcggaaaatatcgctacgttttttggagcttggaaatatccaaaccaaatcgataca
tggagtctcgtacaccttggaaaggtaagttcatggctcttgctagtgattgttagcttt
cttatagtagcatcattaaaacaagttaaggagcagagtcccacaaaggcagagatggat
gaatctttttcttag

DBGET integrated database retrieval system