KEGG   Bacillus subtilis subsp. subtilis 168: BSU18760Help
Entry
BSU18760          CDS       T00010                                 

Gene name
yoaU
Definition
(RefSeq) LysR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_24 MarR_2 Mga MarR
Motif
Other DBs
NCBI-GeneID: 940127
NCBI-ProteinID: NP_389757
Pasteur: BG13491
BSORF: BG13491
UniProt: O34701
Position
complement(2044956..2045828)
Genome map
AA seq 290 aa AA seqDB search
MVMNMNHLHIFVKVGEKLNITEAAKELFISQPAVSKAIKNLESSLQLKLLIRDKHHGLML
TDIGKEILLLARQMKGIESKIYQVANRENKLLNGKVKIGSFPAVSTNIMPQAIAAFRSNY
PLIRIELIEGTSDQIKGWVEDRTVDIGIAASPFEPFENQLLCNDYMVAVIPPQRDELKLE
KHVDLETYQDDLIFCKGGHEIAMSNAFSQYNIELKENLTVQNAETLINMVKNNLGIGIIS
NFTLSSVPHQLIKKDIFPRVTRDIGVIAHSFEEITPAAHEFVKVLKAVVI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggttatgaacatgaaccatcttcacatatttgtaaaagttggggagaaattaaatatt
acagaagcggcaaaagaattgttcatctctcagccggcggtaagtaaagcgataaaaaac
ctggagagctcactgcagctcaaattattgatcagggataaacatcatggtttaatgctg
actgacatcggaaaagaaatattgctgctggcgaggcaaatgaagggaattgaaagcaaa
atatatcaagtagccaaccgggaaaacaagctgttaaacgggaaggtgaaaattggttca
tttcctgcagtttcaacaaatatcatgccacaggcgattgcggcattcagatcaaactac
ccgctgatccgcatagaattgatcgaaggaacctctgaccaaataaaaggatgggttgaa
gatcggacggttgatatcgggatcgcagcatctccatttgaaccgtttgaaaatcagcta
ttgtgtaacgactatatggtggccgtcatcccgccgcagcgtgacgaattaaaacttgaa
aagcatgtcgaccttgaaacatatcaagatgacctcattttttgtaaaggcggtcatgaa
atcgcgatgtcaaacgcattttcgcaatacaacatcgaattaaaggaaaacttaactgtg
caaaatgccgaaaccttgattaatatggtcaaaaataacttgggtatcggcatcatttca
aactttacactttcatccgtcccgcatcaattgattaaaaaggacatctttcctagggtc
acacgcgatattggcgtcatcgcacattcatttgaagagataacgccggcggcgcatgag
tttgtcaaagtgttgaaagcagttgtaatctga

DBGET integrated database retrieval system