KEGG   Bacillus subtilis subsp. subtilis 168: BSU18770
Entry
BSU18770          CDS       T00010                                 

Gene name
cyeA
Definition
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EamA Glyco_transf_5
Other DBs
NCBI-GeneID: 940126
NCBI-ProteinID: NP_389758
Pasteur: BG13492
BSORF: BG13492
UniProt: O34416
Position
2045929..2046807
AA seq 292 aa
MVKVMLGIISVTLIWGYTWVAMKVGIHDIPPLLFSGLRLFIGAVPLFLILFIQRKKLSIQ
KEHLKSYIIMSLLMGLGYMGILTYGMQFVDSGKTSVLVYTMPIFVTVISHFSLNEKMNVY
KTMGLVCGLFGLLFIFGKEMLNIDQSALFGELCVLVAALSWGIANVFSKLQFKHIDIIHM
NAWHLMMGAVMLLVFSFIFEAVPSAEWTYQAVWSLLFNGLLSTGFTFVVWFWVLNQIQAS
KASMALMFVPVLALFFGWLQLHEQITINIILGALLICCGIFMNTFTFSRRKV
NT seq 879 nt   +upstreamnt  +downstreamnt
atggtaaaagttatgctgggaatcatatctgtcacacttatttggggttatacttgggtt
gcgatgaaagtaggaattcatgacatccccccgcttttattttcgggtttgcgcctgttc
atcggagcagttcctttatttctcattctcttcatccaaagaaaaaagctttcaattcaa
aaagaacatctcaaaagctatatcatcatgagcctgttgatggggctgggctatatgggg
attttgacgtatggaatgcagtttgtcgattcagggaaaacctctgttttggtatataca
atgcctatatttgttacggtgatcagccatttttcattaaacgagaaaatgaatgtgtat
aaaacgatgggactggtctgcggcctcttcggactgttatttatatttggaaaggaaatg
ctcaatatcgatcaaagcgctttatttggggagctgtgcgtacttgtggcagcgcttagc
tggggaatcgcgaatgtgttcagcaagctacaattcaagcatatcgatattattcacatg
aatgcctggcaccttatgatgggagccgtcatgttattggtgttttcctttatatttgag
gcggtcccttcagccgagtggacatatcaggcggtgtggtcattgctgtttaatggcttg
ctttccaccggctttacctttgtcgtatggttttgggtgctcaatcaaatccaagcgtca
aaagcatccatggcattaatgtttgttcccgtattggccctattctttggatggctgcaa
ttgcacgaacagatcaccatcaatattatcctcggcgcactgctgatatgctgcgggatt
tttatgaatacatttacattttcacgacggaaagtgtga

DBGET integrated database retrieval system