KEGG   Bacillus subtilis subsp. subtilis 168: BSU18780Help
Entry
BSU18780          CDS       T00010                                 

Gene name
yoaW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraO DUF1425
Motif
Other DBs
NCBI-GeneID: 940131
NCBI-ProteinID: NP_389759
Pasteur: BG13493
BSORF: BG13493
UniProt: O34541
Position
complement(2046980..2047411)
Genome map
AA seq 143 aa AA seqDB search
MKKMLMLAFTFLLALTIHVGEASAVIVKDEEKVSFTMTENEKWFMKSDDLNSNHWTSHFG
YRFTIFDTEGCTINARIMRMTLSGYEITVSEKNFSGDHFDFSATDRVETMPYKTHYLILT
KDPDCGDVKVKGLYGFQFDQPEW
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagatgttgatgttagcttttacatttcttttggctttgactatccatgtaggg
gaagcttcggccgttatcgtgaaagatgaggagaaagtgagttttacaatgacagagaat
gaaaaatggtttatgaagtctgatgacctaaattcaaaccattggacatctcactttggg
tacagattcaccattttcgatactgaaggatgtacaattaacgcaagaatcatgcgaatg
actttgtcaggatatgaaataaccgttagtgaaaaaaacttctcgggggatcattttgat
tttagtgcaactgatcgagttgagacgatgccttataagactcattatttgattttgaca
aaagatccagattgcggagatgttaaagtaaaaggtctatacggttttcagtttgatcag
ccagaatggtaa

DBGET integrated database retrieval system