KEGG   Bacillus subtilis subsp. subtilis 168: BSU18790
Entry
BSU18790          CDS       T00010                                 

Gene name
yoaZ
Definition
(RefSeq) protease YoaZ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DJ-1_PfpI GATase_3
Other DBs
NCBI-GeneID: 940031
NCBI-ProteinID: NP_389760
Pasteur: BG13494
BSORF: BG13494
UniProt: O34947
Position
complement(2047675..2048307)
AA seq 210 aa
MQTRKVYLYVFHTMSDWEYGYLIAELNSGRYFKQDAASLKVVTVGVNKEMITTLGGLSIK
PDISLDECTLGSQDLIILPGGNTWGEDIHQPILKKVGDALKLGTTIAAICGATLGLANEG
YLNSRKHTSNDLDYMNMVCPNYKGETFYEKGPAVSDENLVTASGIAPLEFAVEVLKKLDV
FAPDTLRSWYKLNKTQKPEYFFELMNTINR
NT seq 633 nt   +upstreamnt  +downstreamnt
atgcaaacgagaaaagtttatctctacgtatttcacacaatgtcagactgggaatatgga
tatttaattgcggaactaaactcagggagatactttaaacaagatgcagcatctttaaaa
gtagttacagtaggggttaataaagaaatgataactacgttgggaggattaagcataaaa
ccagatatttctcttgacgaatgtactcttgggagtcaagatcttatcattttacccgga
ggaaacacttggggagaagatattcatcagccgatcttgaaaaaagttggcgacgcttta
aagctcggcacgactattgctgcaatttgtggggcaaccttgggcctcgcgaatgaagga
tacttaaattcgagaaagcacacaagcaatgacctcgactatatgaatatggtctgccct
aattacaaaggagaaacattctatgaaaaggggcctgcagtatctgatgaaaatttggtt
actgcatcaggaattgctcctctggaatttgcggtagaagtattgaaaaaattagatgta
tttgcaccagatacattgcgttcatggtataagctaaataagactcaaaagcctgaatat
ttctttgagctaatgaatacaataaatcgatag

DBGET integrated database retrieval system