KEGG   Bacillus subtilis subsp. subtilis 168: BSU18800Help
Entry
BSU18800          CDS       T00010                                 

Gene name
penP
Definition
(RefSeq) beta-lactamase
  KO
K17836  beta-lactamase class A [EC:3.5.2.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00311  Penicillin and cephalosporin biosynthesis
bsu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    BSU18800 (penP)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU18800 (penP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bsu01504]
    BSU18800 (penP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     BSU18800 (penP)
Antimicrobial resistance genes [BR:bsu01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    BSU18800 (penP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase2 Beta-lactamase Transpeptidase
Motif
Other DBs
NCBI-GeneID: 940129
NCBI-ProteinID: NP_389761
Pasteur: BG11016
BSORF: BG11016
UniProt: P39824
Structure
PDB: 

Position
2048533..2049453
Genome map
AA seq 306 aa AA seqDB search
MKLKTKASIKFGICVGLLCLSITGFTPFFNSTHAEAKSIEDTNMASCITNKKFVQLEKKF
DARLGVYAIDIGSNKTIAYRPNERFAYASTYKVLAAAAVLKKNSIEKLNEVIHYSKDDLV
TYSPITEKHLDTGMSLKEISEAAIRYSDNTAGNILLQQLGGPKGFEKSLKQIGDHVTKAK
RFETDLNSAIPGDIRDTSTAKALATDLKAFTLDNTLTTDKRMILTDWMRGNATGDELIRA
GAPIGWEVGDKSGAGSYGTRNDIAIVWPPNRAPIVVAILSNRFTKDANYDNALIAEAAKV
VLNDLK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaaaactaaagcgtcaataaaattcggaatatgtgttgggcttttatgttta
agcattactggtttcacaccttttttcaactcaacacatgccgaagcaaaatccatagaa
gacacaaacatggcaagctgtataacgaataaaaaatttgttcaacttgagaaaaaattt
gatgccaggcttggtgtttatgcaattgatataggttcaaacaagacaatcgcctatcgg
ccgaatgaacgatttgcttacgcatcaacctataaagttctagccgcagctgctgtcctg
aagaaaaactcaattgaaaaacttaatgaagtcatccactacagcaaggacgatcttgtt
acatattctccaatcacagagaaacacctagatacaggcatgagcctaaaagaaatctcg
gaagcggctatccgttacagcgataataccgctgggaacatcttgttgcaacagcttggc
ggccctaaaggttttgaaaagtcactgaaacagattggggatcatgtaacgaaagctaaa
cgattcgagacggatctaaactctgcgattcctggtgatattcgtgacaccagcaccgca
aaagcactggcaaccgatcttaaagccttcactttagataacactctcacgactgacaaa
cgcatgatcttaaccgattggatgcgaggcaatgctactggtgacgaactgattcgggca
ggcgctccaataggatgggaagtcggcgataaatccggagccggaagttacgggacacga
aacgacattgctatcgtttggccgccaaacagagctcctattgttgtggcaattctgtca
aaccgctttacgaaagatgctaattatgataatgctcttatcgctgaggctgcaaaagtc
gtccttaacgatctcaaataa

DBGET integrated database retrieval system