KEGG   Bacillus subtilis subsp. subtilis 168: BSU18810
Entry
BSU18810          CDS       T00010                                 

Gene name
yobA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3221
Other DBs
NCBI-GeneID: 940122
NCBI-ProteinID: NP_389762
Pasteur: BG13495
BSORF: BG13495
UniProt: O31835
Structure
PDB: 
4QY7 2JQO

Position
complement(2049950..2050312)
AA seq 120 aa
MPKIGVSLIVLIMLIIFLAGCNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKE
DYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELL
NT seq 363 nt   +upstreamnt  +downstreamnt
atgcctaaaatcggagtaagcttgatagtgctcattatgctcattattttccttgcaggc
tgcaataaaaatgaacaaaacggagacgaaacaaagatgcagagcctagtaggctatgtc
gtgcttaaagacaatgaaagggcaattctcattaccgatacaaaagctccaggaaaagaa
gattacaatctttctgaaggacaacttatgaacaagtttaaaaataacatagtaattgta
ggattaagtgagattgataacacagatgatctcaaaagaggtgaaaaaataaaagtgtgg
ttccatacacgaaaagagtcaaatccaccaagtgcaacgatacaaaaatatgaattatta
taa

DBGET integrated database retrieval system