KEGG   Bacillus subtilis subsp. subtilis 168: BSU18820Help
Entry
BSU18820          CDS       T00010                                 

Gene name
yobB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 940049
NCBI-ProteinID: NP_389763
Pasteur: BG13496
BSORF: BG13496
UniProt: O31836
Position
2050689..2050952
Genome map
AA seq 87 aa AA seqDB search
MKIRKILLSSALSFGMLISAVPALAAGTSSEVAVKNEEYDYDTIYRISPLPMDFQPTIEY
NGYTYTLTRHYFDYSIGFYTAIYTKVV
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattaggaaaatcttattgagttctgctttatcctttggcatgctaatatccgcg
gttcccgcattggctgctggcacttcgtctgaggttgcagtaaaaaatgaagaatatgat
tatgacactatataccgcattagtcctctgccaatggacttccagccaacaatagaatac
aacggttatacttatacgcttacacgtcattattttgattactcaatcgggttttacacg
gctatttatacaaaagttgtttaa

DBGET integrated database retrieval system