KEGG   Bacillus subtilis subsp. subtilis 168: BSU18830Help
Entry
BSU18830          CDS       T00010                                 

Gene name
pps
Definition
(RefSeq) phosphoenolpyruvate synthase
  KO
K22579  rifampicin phosphotransferase [EC:2.7.9.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU18830 (pps)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.6  rifampicin phosphotransferase
     BSU18830 (pps)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPDK_N PEP-utilizers
Motif
Other DBs
NCBI-GeneID: 939985
NCBI-ProteinID: NP_389764
Pasteur: BG12657
BSORF: BG12657
UniProt: O34309
Position
complement(2051329..2053929)
Genome map
AA seq 866 aa AA seqDB search
MSSLVLGLHEIEKTQLSLVGGKGLHLGELSKIQGIQVPEGFCVTTVGYQKAIEQNETLQV
LLDQLTMLKVEDRDQIGNISRKIRQIIMEVDIPSDVVKAVAQYLSQFGEEHAYAVRSSAT
AEDLPHASFAGQQDTYLNITGVDAILQHISKCWASLFTDRAVIYRMQNGFDHSQVYLSVI
VQRMVFPQASGILFTADPITSNRKVLSIDAGFGLGEALVSGLVSADCFKVQDGQIIDKRI
ATKKMAIYGRKEGGTETQQIDSDQQKAQTLTDEQILQLARIGRQIEAHFGQPQDIEWCLA
RDTFYIVQSRPITTLFPIPEASDQENHVYISVGHQQMMTDPIKPLGLSFFLLTTVAPMRK
AGGRLFVDVTHHLASPDSREVFLKGMGQHDQLLKDALMTIIKRRDFIKSIPNDKTAPNPS
RGNADMPAQVENDPTIVSDLIESSQTSIEELKQNIQTKSGSDLFRFILEDIQELKKILFN
PKSSVLIRTAMNASLWINEKMNEWLGEKNAADTLSQSVPHNITSEMGLALLDVADVIRPY
PEVIDYLQHVKDDNFLDELAKFDGGSKTRDAIYDYLSKYGMRCTGEIDITRTRWSEKPTT
LVPMILNNIKNFEPNVGHRKFEQGRQEALKKEQELLDRLKQLPDGEQKAKETKRAIDIIR
NFSGFREYPKYGMVNRYFVYKQALLKEAEQLIEAGVIHEKEDIYYLTFEELHEVVRTHKL
DYQIISTRKDEYTLYEKLSPPRVITSDGEIVTGEYKRENLPAGAIVGLPVSSGVIEGRAR
VILNMEDADLEDGDILVTSFTDPSWTPLFVSIKGLVTEVGGLMTHGAVIAREYGLPAVVG
VENAAKLIKDGQRIRVHGTEGYIEIF
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgagttctttggttctcggtttacatgaaattgaaaaaacacagctttcgctcgttgga
ggaaaagggttacatttaggggaattatcaaaaattcaaggtatacaagtaccagaagga
ttttgtgtcacaacagtaggatatcaaaaagccatcgaacaaaacgaaacgttacaagtg
ttgttggatcaattgaccatgctaaaagttgaggaccgagatcagattggtaacatcagc
cggaagattcggcaaatcattatggaagtagacattccttccgatgttgtgaaagcagtg
gctcaatatctctcccagtttggcgaggaacatgcctatgccgtgcgttctagtgcgact
gctgaggatttaccacatgcttcttttgccggtcaacaagacacctatttaaatattacc
ggcgtcgatgcaatcttgcagcatatcagtaaatgctgggcgtccctatttacggatcgc
gcggttatttaccgtatgcaaaatggatttgaccacagccaagtctatttatccgttatc
gttcaaaggatggttttccctcaggcttcggggattttatttaccgctgatccgattacc
tccaaccgaaaggtgttatccatcgatgccggttttggacttggtgaagcactggtttct
ggcttggtatctgccgattgttttaaagtacaggatgggcaaatcatcgataagagaata
gcaactaaaaaaatggctatctacggacgaaaagaaggcggaacagaaacacagcagatc
gattctgatcagcaaaaggctcaaacactgactgatgaacaaattttacagctggcacgc
attggaagacagatcgaagctcatttcggccagccgcaagatatcgaatggtgtttggcc
cgcgatactttttatattgtacagagtcgtccaatcactactttattccccatccctgaa
gcgagtgaccaagaaaatcacgtctatatttctgttggtcatcaacaaatgatgacggat
cccataaaaccactgggattgtctttttttctgttgacgactgttgcacccatgcgtaaa
gccggtggaaggctatttgttgatgtcacacatcatctggcatcccctgacagcagagaa
gttttcttaaaaggcatggggcagcacgatcagctcttaaaagacgcacttatgaccata
ataaagcgacgagatttcataaagtcgataccaaatgataaaacagcaccaaatcccagc
agaggcaatgcagatatgccggctcaagttgaaaacgatccgacaatcgtgtctgatttg
attgagagcagtcaaacatcgatagaagagttaaaacaaaacatccaaacgaaatcagga
tcagatttatttcgttttattctggaagatattcaggaattaaagaagattttatttaac
ccaaaaagttcggttctaattcgaactgctatgaatgcttcattatggattaacgaaaaa
atgaacgagtggttaggtgaaaaaaacgcagcagatacgctttctcaatctgtaccccat
aatattacttcagaaatgggtcttgcgctattagacgtcgcagatgtgattcgtccttat
ccagaggtaattgattacttacaacatgtaaaagatgataactttttggatgaactggct
aagtttgatggcggaagcaaaacccgagacgcgatctatgattatctcagcaaatacgga
atgcgatgtaccggagagattgatatcacaagaactcgatggagcgaaaaaccaactaca
cttgtcccaatgattcttaataatattaaaaattttgagcctaatgtcggccatcggaaa
tttgagcaagggcgacaggaagctttgaagaaagaacaagagttattagatcgattgaag
caattaccggatggtgaacaaaaagccaaagaaacaaaacgagcgatagatatcatccgg
aatttcagcgggtttagggaatatccaaaatacggcatggttaatcgatacttcgtttat
aagcaggctttactgaaagaagccgaacaactcatagaagcgggcgttattcatgaaaaa
gaagatatatactatctcacttttgaagaacttcacgaagtcgtgcgcacacataaactg
gattatcaaatcatcagtacacgaaaagacgagtacacattatatgaaaaactatctcca
ccacgtgttatcacgtctgatggtgaaatcgttacaggtgagtataaacgagaaaatctc
ccagccggagcgattgtaggtctacctgtttcctccggagttatagaggggcgagcgcgt
gtcattttaaacatggaagatgcggatttagaagatggagatatattagttacctccttt
accgatccaagctggacaccattgtttgtatccataaaaggcctagtcaccgaagttggg
gggctgatgacccatggagctgttatagcccgtgaatatggcttacctgcagttgttggc
gttgaaaatgctgccaagctgataaaagatgggcaacgaattcgcgttcatggtacagaa
ggctacattgaaatcttctaa

DBGET integrated database retrieval system