KEGG   Bacillus subtilis subsp. subtilis 168: BSU18840Help
Entry
BSU18840          CDS       T00010                                 

Gene name
xynA
Definition
(RefSeq) endo-1,4-beta-xylanase A
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     BSU18840 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_11
Motif
Other DBs
NCBI-GeneID: 939861
NCBI-ProteinID: NP_389765
Pasteur: BG10808
BSORF: BG10808
UniProt: P18429
Structure
PDB: 

Position
complement(2054599..2055240)
Genome map
AA seq 213 aa AA seqDB search
MFKFKKNFLVGLSAALMSISLFSATASAASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSN
TGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTG
TYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNA
WKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtttaaaaagaatttcttagttggattatcggcagctttaatgagtattagc
ttgttttcggcaaccgcctctgcagctagcacagactactggcaaaattggactgatggg
ggcggtatagtaaacgctgtcaatgggtctggcgggaattacagtgttaattggtctaat
accggaaattttgttgttggtaaaggttggactacaggttcgccatttaggacgataaac
tataatgccggagtttgggcgccgaatggcaatggatatttaactttatatggttggacg
agatcacctctcatagaatattatgtagtggattcatggggtacttatagacctactgga
acgtataaaggtactgtaaaaagtgatgggggtacatatgacatatatacaactacacgt
tataacgcaccttccattgatggcgatcgcactacttttacgcagtactggagtgttcgc
cagtcgaagagaccaaccggaagcaacgctacaatcactttcagcaatcatgtgaacgca
tggaagagccatggaatgaatctgggcagtaattgggcttaccaagtcatggcgacagaa
ggatatcaaagtagtggaagttctaacgtaacagtgtggtaa

DBGET integrated database retrieval system