KEGG   Bacillus subtilis subsp. subtilis 168: BSU18849Help
Entry
BSU18849          CDS       T00010                                 

Gene name
yozV
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TM2
Motif
Other DBs
NCBI-GeneID: 8303004
NCBI-ProteinID: YP_003097736
UniProt: C0H423
Position
complement(2055868..2056107)
Genome map
AA seq 79 aa AA seqDB search
MVSKKNKIVAALLAFFFGGLGIHKFYLGRVGQGILYILFCWTGIPSIIAFIEFIIFLCGS
EEGFDQKYNFYYFQQQSKA
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaagaagaacaaaattgtagcggcattattagcatttttcttcgggggtctg
ggaatacataagttttatttgggaagagtaggacaaggtattctatatattttgttttgc
tggactggtatcccctctattatcgcatttattgaattcattatttttctttgtggtagc
gaagaagggtttgatcaaaagtacaatttttattactttcagcagcaatctaaagcttaa

DBGET integrated database retrieval system