KEGG   Bacillus subtilis subsp. subtilis 168: BSU18860Help
Entry
BSU18860          CDS       T00010                                 

Gene name
yozH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939603
NCBI-ProteinID: NP_389767
Pasteur: BG13755
BSORF: BG13755
UniProt: O31837
Position
complement(2056650..2057006)
Genome map
AA seq 118 aa AA seqDB search
MNDLLFAAGNLHIGLGHDYLKCIALLINVKRFFSLTESYGNISDKLAVVAMKGVQFDQFE
EAYKAYKETVAINQNSLVDFLSALITLIKAGEKLQKAGESLAIIMNKLLEMSPENSMK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgatttgctgtttgctgcaggcaatttacatattggtctggggcacgattattta
aagtgcattgccttactaatcaatgtcaaaagattttttagtttaacagagtcatatgga
aatatttcagataaattagctgttgttgctatgaaaggtgtgcaatttgatcagtttgaa
gaagcttacaaagcttataaagaaacagttgcaataaatcaaaatagcttagtggacttt
ttaagtgctttaattactctgataaaagcaggtgagaagctacaaaaagctggtgaaagt
ttagctatcatcatgaataaacttcttgaaatgagtccagaaaattcaatgaaataa

DBGET integrated database retrieval system