KEGG   Bacillus subtilis subsp. subtilis 168: BSU18880Help
Entry
BSU18880          CDS       T00010                                 

Gene name
yobE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRAP
Motif
Other DBs
NCBI-GeneID: 939611
NCBI-ProteinID: NP_389769
Pasteur: BG13498
BSORF: BG13498
UniProt: O34915
Position
2057801..2058460
Genome map
AA seq 219 aa AA seqDB search
MCGKFTLFSEFDDIIEQFNIDQFLPEGEYHPSYNVAPSQNILTIINDGSNNRLGKLRWGL
IPPCAKDEKIGYKMINARAETLAEKPSFRKPLGSKRCIIPADSFYEWKRLDPKTKIPMRI
KLKSSNLFAFAGLYEKWNTLEGNLLYTCTIITIKPSELMEDIHDRMPVILTDENKKEWLN
PKNTDPDYLQSLLLPYDADDMEAYQVSSLVNSPELIESH
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcaagttcactttattttctgagtttgatgacatcattgagcaattcaacata
gatcaattcttacctgaaggtgaatatcaccctagctataatgtcgctccttcacaaaac
atcctgacaattatcaacgatggatctaataaccgtctgggtaaacttagatggggtctt
atccctccttgtgctaaagacgaaaagatcggttataaaatgattaatgctcgtgctgaa
acattggccgagaaacccagctttcgaaagccgctcggaagcaaacgttgtatcataccg
gctgacagtttttatgaatggaaacgccttgatccaaagactaagattcctatgcggatt
aaacttaaatcgtcgaatctctttgcttttgccggcttatatgaaaagtggaacacgcta
gaaggcaatctgttgtacacttgcacaatcatcacaataaagcctagtgagcttatggaa
gacattcatgatcggatgccagttatcctaactgatgagaacaaaaaggaatggctaaat
cctaaaaatactgatcctgattatctacaaagcttgttgctgccttatgatgctgatgac
atggaagcatatcaggtatcttcattagtgaattcacctgagctcattgaatcccattaa

DBGET integrated database retrieval system