KEGG   Bacillus subtilis subsp. subtilis 168: BSU18890Help
Entry
BSU18890          CDS       T00010                                 

Gene name
yobF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BtrH_N Peptidase_C39 Peptidase_C39_2
Motif
Other DBs
NCBI-GeneID: 939609
NCBI-ProteinID: NP_389770
Pasteur: BG13499
BSORF: BG13499
UniProt: O34780
Position
complement(2058715..2059638)
Genome map
AA seq 307 aa AA seqDB search
MLVYIGNGHYCYSNSTAMFLSSIGENVSPQLVEILTGVGLGAMIEYEKNLYFSMRDPDDG
INYALNILGFTAEEHQQASDLDDPFPLLKQQIKQNPVILGPLDMGELTYHPNHKNLNGSD
HYVLGYQMDNENIYVQDPAGFPFVPLSLDQFKKAWMAERIPYRKGINKYWSTAKKVVTLD
NNEIYERAIDYFKRTYRKFEKVDIGLIGREAICFYADQLLNAPITADTIRHTTFFLFQLS
ARRANDYAMYFKDRHSHLSVLKTEQAKVFGICHSMSVNKDWKGISEKLMKLADLEDNFRL
ELLKVGY
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgttagtgtatataggaaatggccattactgttattcaaattcaactgcaatgtttctt
tcatcaataggagaaaatgtatctcctcaacttgtagagatattaactggtgttgggtta
ggtgccatgatagaatatgaaaaaaacctttattttagtatgagagatcctgatgatggt
atcaattatgctttaaacatccttggatttactgcagaagaacatcagcaagctagtgac
ttagatgacccatttccgttattaaaacagcaaatcaaacaaaaccctgtcattctaggc
cctttagatatgggggagctaacataccatccgaatcataaaaatttaaatggttctgac
cattatgttctagggtaccaaatggataatgaaaatatttatgtgcaagatccagcaggc
tttccatttgttccattatcactggaccaatttaagaaggcttggatggcggaaaggatt
ccgtataggaaaggaatcaataaatattggtctacagcaaaaaaggttgtcacattagac
aataacgaaatatacgagagagcaattgattattttaagagaacttatcggaaattcgaa
aaagtggatatagggttaattggaagggaagcaatttgtttttatgctgatcaattatta
aatgcccctattacagctgatactataaggcatacaacattcttccttttccaattaagt
gcaagaagggccaacgattatgcaatgtattttaaagataggcattcacatttatcagtg
ttgaagactgaacaggctaaggtgtttgggatatgtcattctatgtctgtaaataaagat
tggaaaggtatatcggagaagttaatgaagctagccgatttagaggataattttagattg
gaacttttaaaagtcggctattaa

DBGET integrated database retrieval system