KEGG   Bacillus subtilis subsp. subtilis 168: BSU18898
Entry
BSU18898          CDS       T00010                                 

Gene name
yozW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303072
NCBI-ProteinID: YP_003097737
UniProt: C0H424 A0A6M3ZBH2
Position
complement(2059691..2059864)
AA seq 57 aa
MTEIKANSTVMIHVLADETLSSIKREYVEVDRKTEIGEKIIIVDKNDPDDEYENGAI
NT seq 174 nt   +upstreamnt  +downstreamnt
atgacggaaattaaagcgaactcaactgtaatgattcacgtactggctgacgaaacactt
agcagcatcaagcgcgaatacgtagaggtcgatcgtaaaacggagattggcgagaagatc
attattgttgataaaaatgatccagatgatgaatacgagaacggagcaatttaa

DBGET integrated database retrieval system