KEGG   Bacillus subtilis subsp. subtilis 168: BSU18899
Entry
BSU18899          CDS       T00010                                 

Gene name
yozX
Definition
(RefSeq) protein YozX
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303068
NCBI-ProteinID: YP_003097738
UniProt: C0H425
Position
2060009..2060233
AA seq 74 aa
MNFLLDLFTNWTFDKVLDYTLAAVIWSVFKSRSKQNKYPGYFEKIRRYRNLHPLLRSLSM
RVLLSITIHPYMFS
NT seq 225 nt   +upstreamnt  +downstreamnt
atgaattttcttcttgatctttttacaaattggacttttgataaagtcctggattataca
ctagctgctgtaatttggtctgtatttaaatccagatcaaagcagaataagtatccaggc
tatttcgagaaaatacgccgctatagaaatttacatccccttctgcgatcgttatcgatg
cgtgtacttttatcgataacgatccatccttatatgtttagttaa

DBGET integrated database retrieval system