KEGG   Bacillus subtilis subsp. subtilis 168: BSU18900Help
Entry
BSU18900          CDS       T00010                                 

Gene name
yozJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939606
NCBI-ProteinID: NP_389771
Pasteur: BG13757
BSORF: BG13757
UniProt: O31839
Position
complement(2060237..2060692)
Genome map
AA seq 151 aa AA seqDB search
MADRYVLIEVNEDGEGRLKDEAVTWIDFRLSIVDFNASEGLNQLMEQISKDVKDELVLVL
FNYRVKSSYDSWSGATEYEDFFDVEFFKVIKKNYKKFYQGLVTVELDVGINGFDNIESMP
TDSNQNYYRNLIAEWEEFYNEDFIPLSLNKR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggctgacagatatgtattaattgaagtgaatgaagacggagaaggaaggttaaaagat
gaagctgttacttggattgacttccgattaagcattgtagattttaatgccagtgaagga
ctaaatcaattaatggagcaaatatcaaaagatgtgaaagatgagttagttttggttctt
tttaattatcgtgttaagtcctcttatgattcttggagtggagcaactgaatatgaagac
ttctttgatgttgaatttttcaaagtaattaaaaagaattataagaagttttaccaagga
ttagtgacagtagaattagatgtcggtattaatggttttgacaatattgaatctatgcca
accgactctaaccaaaactattatagaaacttaattgctgagtgggaagagttttacaat
gaagattttatcccattaagtctaaataaaagatag

DBGET integrated database retrieval system