KEGG   Bacillus subtilis subsp. subtilis 168: BSU18908Help
Entry
BSU18908          CDS       T00010                                 

Gene name
yozY
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5065
Motif
Other DBs
NCBI-GeneID: 8303063
NCBI-ProteinID: YP_003097739
UniProt: C0H426
Position
2060817..2061077
Genome map
AA seq 86 aa AA seqDB search
MNLRKILLSSALSLGMLVSAAPVLATSSSSEVIVKSDEYDYDTIYQLSPLPNFKPSIEYN
GYTYTLTRYYFDYSIQFYTAIYTKVV
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccttcgaaaaattttattgagttctgctttatcattaggtatgctggtatctgct
gctcctgtcttggcaacaagttcttcgtctgaagtgatagtaaaaagtgatgaatatgat
tatgacaccatatatcagcttagccccctaccaaacttcaagccttctattgaatacaat
ggatatacttatactctcacacgttattatttcgattactcaattcagttttatacggct
atttatacaaaagttgtttaa

DBGET integrated database retrieval system