KEGG   Bacillus subtilis subsp. subtilis 168: BSU18920
Entry
BSU18920          CDS       T00010                                 

Gene name
phrK
Definition
(RefSeq) phosphatase RapK inhibitor
  KO
K06358  phosphatase RapK regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU18920 (phrK)
SSDB
Motif
Pfam: SMP_2
Other DBs
NCBI-GeneID: 939608
NCBI-ProteinID: NP_389773
Pasteur: BG12646
BSORF: BG12646
UniProt: O31840 A0A6M4JN85
Position
2063262..2063384
AA seq 40 aa
MKKLVLCVSILAVILSGVALTQLSTDSPSNIQVAERPVGG
NT seq 123 nt   +upstreamnt  +downstreamnt
atgaaaaaacttgtgctttgcgtatctattttagctgtgattttaagtggagtagcttta
acgcaattgagtacagattcaccatctaacatccaggtagctgaaaggccagtcggaggt
taa

DBGET integrated database retrieval system