KEGG   Bacillus subtilis subsp. subtilis 168: BSU18930
Entry
BSU18930          CDS       T00010                                 
Symbol
yobH
Name
(RefSeq) DNA repair protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: IMS_C IMS_HHH IMS POLH-Rev1_HhH
Other DBs
NCBI-GeneID: 939613
NCBI-ProteinID: NP_389774
Pasteur: BG13500
UniProt: C0SPA8
Position
complement(2063510..2064163)
AA seq 217 aa
MAKAIQSSMWREFGLMCTVGIGDNMLLSKLALDLESKKTKSGIARWRYEDVPNRLWKVRP
LSKMWGIGGRMERNLNRMGISTVGQLAKFPLELLEKKFGIMGNQLYYHAHGIDLSEIGAP
LMQGQISFGKSQILFRDYTKREEIKAVLLEICEEVARRARTYNKVGRTISLGIGYSKDEL
GGGFHRSKTIDFPTNITMDIYKCCLMFFNKFYSGKKQ
NT seq 654 nt   +upstreamnt  +downstreamnt
atggccaaagcaatccaaagcagcatgtggagagaatttggtttgatgtgcacagttgga
attggtgacaatatgttgcttagtaagcttgcacttgacctggagagtaagaaaacaaag
agtggtattgcacgttggagatatgaagatgtgccaaatagactctggaaagttcgacct
ttgtctaaaatgtgggggataggagggaggatggaaagaaatctgaatcgaatgggtata
tcaactgtaggtcagttagctaaatttcctttagagctgcttgaaaagaagttcggaata
atgggaaaccagttgtactatcatgctcacggaattgatttatctgaaataggagctcca
ttgatgcaggggcagattagttttggtaagagtcagattttgtttagggattatacaaag
agagaagagattaaagctgtgctcttggagatttgtgaggaagtcgcaagaagggcacgt
acatataataaagttggtcgaacaataagtctaggaattggatacagtaaagatgagctt
ggcggtggttttcatcgatccaaaacaattgattttcccacaaatatcacgatggatatt
tataagtgttgcttgatgttctttaataagttttactcgggcaaaaaacagtga

DBGET integrated database retrieval system