KEGG   Bacillus subtilis subsp. subtilis 168: BSU18940Help
Entry
BSU18940          CDS       T00010                                 

Gene name
yozK
Definition
(RefSeq) DNA repair protein UvrX
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMS
Motif
Other DBs
NCBI-GeneID: 939614
NCBI-ProteinID: NP_389775
Pasteur: BG13758
BSORF: BG13758
UniProt: O31841
Position
complement(2064200..2064547)
Genome map
AA seq 115 aa AA seqDB search
MTDYSQFPRENILCVDMKSFYASVSAVAMGLNPLTCYLAVVGNTDRQGSVVLAASPALKK
DFGIKTGSRLFEIPEDPRIYIVNPQMKLFIRVSTEITKLFYRFVPEKCVHTYSID
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgactgattactcacaatttccacgtgagaatatactctgtgtcgatatgaaatccttt
tatgcttctgtatcggctgtagcaatggggcttaatcctttaacatgttatcttgccgtt
gtagggaatacggatagacagggaagtgtagtgttagctgcatctcctgcacttaaaaaa
gattttggaatcaaaacaggatcgagactatttgagatacctgaagatccaagaatatac
attgtaaatccacaaatgaagcttttcatcagagtttcaactgagattacaaagctgttt
tacagatttgttcctgaaaaatgtgtccacacgtattcaattgattaa

DBGET integrated database retrieval system