KEGG   Bacillus subtilis subsp. subtilis 168: BSU18950
Entry
BSU18950          CDS       T00010                                 

Gene name
yozL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YolD
Other DBs
NCBI-GeneID: 939619
NCBI-ProteinID: NP_389776
Pasteur: BG13759
BSORF: BG13759
UniProt: O31842
Position
complement(2064540..2064833)
AA seq 97 aa
MMLEQLIQLKQDLIDGSKVEKPSLDDKQIDEMDILVSEALEFNKELKFKLFNKGFVENVT
GRVHYINFEQQKLHVKDQNDNTVYINMNNIIRVIYND
NT seq 294 nt   +upstreamnt  +downstreamnt
atgatgctagaacaattaatacagcttaaacaagatttgattgatggatcaaaagttgaa
aagccatctttagatgacaaacaaattgatgagatggatattctcgtttctgaggcattg
gaatttaataaagagttgaaattcaaactctttaacaagggatttgttgaaaatgttacc
ggcagagtacattacattaattttgaacaacaaaagcttcacgtaaaagaccagaacgac
aatacagtttatatcaacatgaataacatcataagagttatatacaatgactga

DBGET integrated database retrieval system