KEGG   Bacillus subtilis subsp. subtilis 168: BSU18960
Entry
BSU18960          CDS       T00010                                 

Gene name
yozM
Definition
(RefSeq) prophage-derived-like protein YozM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939622
NCBI-ProteinID: NP_389777
Pasteur: BG13760
BSORF: BG13760
UniProt: O31843 A0A6M4JH41
Position
2065042..2065377
AA seq 111 aa
MKKRLIGFLVLVPALIMWGITLIESNKKTPVEVLESAWDEFGLFSFEIGITDPAITIGMD
QTKSEAKLREYLKDNLSREAKEKYKIYIFKDDTDKLEKEHQEYLKENNLNK
NT seq 336 nt   +upstreamnt  +downstreamnt
atgaagaagaggttaattggatttttggtcttagttcctgctttgattatgtggggtata
actttaatcgaatcaaacaaaaagacccctgtagaagttttagaaagtgcttgggatgaa
tttgggttatttagttttgaaattggaataacagatccggcaattacaataggcatggat
caaaccaaaagtgaagcaaaactccgtgaatatttaaaagataatctgtctagagaagcc
aaggaaaaatataagatttatatattcaaggatgatactgataagctggagaaagagcat
caagaatatttgaaagaaaataatctcaataagtaa

DBGET integrated database retrieval system