KEGG   Bacillus subtilis subsp. subtilis 168: BSU18980
Entry
BSU18980          CDS       T00010                                 

Gene name
yobJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PRA1
Other DBs
NCBI-GeneID: 939633
NCBI-ProteinID: NP_389779
Pasteur: BG13502
BSORF: BG13502
UniProt: O34774
Position
complement(2070244..2071086)
AA seq 280 aa
MELLDIWNWIQQNGILTAVITGIVALLFNQRQKSIERFYSQSGETLEKILEPMYYSLKEI
KNEEDENHKMVLIEKFFEEYSGKKGKLSKLRNILLIDQILNTEDCFREYILNKNSENRKK
LFYKMRMLDQAVNKEYRSIFVTLNKNYNWYKVLFRTNYILSAVFVFVRWFKETLAFFVGA
SAFAFIPLLYDKYLGEQVLGNWLEVNKLIFGLSCSALYIFWIIHYFLLKDTMQRKDEISL
FQEWFDKTKLGKWTNKNVWGKIGNWNVERRARRVRNDEDV
NT seq 843 nt   +upstreamnt  +downstreamnt
ttggagttattagatatttggaattggatacaacaaaatggtattcttactgcagtaatt
acgggtatagttgcattgctattcaatcaaagacaaaaaagtatagaacgattctactct
caatcaggtgaaacattagaaaaaattttagagcctatgtattattccctaaaagaaata
aagaatgaagaagatgaaaaccataaaatggtccttatagaaaaatttttcgaagaatat
agtgggaaaaaggggaagctatcaaaacttagaaacatcttattgatagatcaaattttg
aatacagaagattgtttcagagagtatattttaaacaagaacagcgagaataggaaaaaa
ttattttataaaatgagaatgttagatcaagcagttaataaagaatatagaagtatattt
gttactctaaacaagaattataattggtataaagttctttttagaacgaattatatttta
agcgctgtttttgtttttgttagatggtttaaagaaactctagctttttttgtcggtgct
tcagcatttgcttttataccccttctatatgataaatatttaggcgaacaagttttagga
aattggttagaggtaaataaacttatttttggactttcttgttcagctctttatatcttt
tggataatacattatttccttttaaaagatacaatgcaaaggaaagatgaaatatctttg
tttcaggaatggtttgataaaactaagctagggaaatggactaacaagaatgtctgggga
aagattgggaattggaatgttgaaagacgagctagaagagtaagaaatgatgaagatgta
taa

DBGET integrated database retrieval system