KEGG   Bacillus subtilis subsp. subtilis 168: BSU19000
Entry
BSU19000          CDS       T00010                                 

Gene name
yobL
Definition
(RefSeq) hypothetical protein
  KO
K21487  toxin YobL [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU19000 (yobL)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU19000 (yobL)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YobL-YobK
    BSU19000 (yobL)
SSDB
Motif
Pfam: LXG LHH Nif11
Other DBs
NCBI-GeneID: 939624
NCBI-ProteinID: NP_389781
Pasteur: BG13504
BSORF: BG13504
UniProt: O34330
Position
complement(2071754..2073556)
AA seq 600 aa
MKVFEADSLLFEADKRTKEYKELRSQMVKLKKAFKEVANLDDSEFSGKGADNIKAFYHGH
VGVTDQWIDLIDMKIAFLSSMSATLEDAKMSDAYIEESFLEHELANAYAKSKSIMSEQKK
AMKDILNNINDILPLEIFSTEDFKDKLSSADDKREKTIDKLNKLDEDLKTEYAETEPNEQ
FIQQDFKKLQESTGKGKNATPIHYNAKAYRESDIHKKKGDIEKHSEAYLSVKKEEAKERE
IKELKKKLNDGVSDPDEYLEIAKKVGYENLEPTQVQLAVQIEQAKQLEGAGEITWDIVKG
VGVGLYDVGKDTVTGIWDFITDPGETLSALGNAAMHPVKTYDAISAAIEESYQKDMVNGD
AYSRSRWVTYAIGSVAVAVVGTKGAGAINKADAAGKVINKASQAGKKIKDVKIPDLLPYN
PKYKLALADNVPYNVVDSQNLKNELLTNAKKIPDGTRKPFTGQKKSPPWLNKEKYDAYEI
EGKVKAKGKVKDVSRRVYTMKDIDINQKTEFGVTNLQLMKNGNAPYAKDGTQINLHHLIQ
EEPGPMLEIPNSLHTKYSDVIHQLKSDGESFRNDKVLKAQYESFRKRYWKWRAKQFENEN
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgaaggtatttgaggctgattcattactctttgaagcggataaaagaaccaaagagtat
aaggaactaaggtcgcaaatggtgaagctcaaaaaagcgtttaaggaagtagctaaccta
gatgacagtgaattttcaggcaagggtgctgacaacattaaagcattttatcatggtcat
gtcggcgtaacagaccaatggattgatcttatcgatatgaagattgctttcttaagcagc
atgtctgcaacacttgaagatgcgaagatgtctgatgcttacatagaagaatcctttcta
gaacacgagttggctaacgcttatgcaaaatcaaaatccattatgtctgaacagaaaaaa
gcaatgaaagacatattaaacaacatcaatgatatccttccccttgaaatattctcaaca
gaagacttcaaagacaaactttcttctgcagatgacaaacgtgaaaaaacaatcgataag
ctaaacaagcttgatgaggatttaaaaacagaatacgctgaaacagaaccaaacgaacaa
tttattcagcaagactttaaaaagctgcaggaatcaacaggcaaaggaaaaaacgctaca
ccaattcactataacgctaaagcgtacagagaaagtgacatacataagaaaaaaggcgat
attgaaaagcattctgaagcttacttaagtgtgaagaaagaagaagcaaaggaacgtgaa
atcaaggaattaaagaaaaaacttaatgacggtgtatctgaccctgatgaatatttagag
attgctaagaaagtagggtacgagaatctggagccaactcaagtgcagcttgcagtgcaa
attgaacaagcgaagcagctagaaggagcaggagaaatcacctgggatatcgtaaaaggt
gtaggagttggtttatacgatgtaggaaaagacactgtaaccggcatatgggacttcatc
accgatccaggagaaacactctcagcactgggtaatgcagctatgcatccagtgaaaaca
tacgatgccatttcagcagcaatagaagagtcatatcaaaaggatatggtgaatggagat
gcctattctagatcaagatgggttacctatgctattggttcagtggctgtagctgttgtt
ggtacaaaaggtgcaggagccattaacaaagcagatgcagcgggcaaggtaataaataaa
gcaagtcaagcaggtaagaaaatcaaggacgttaagattccagatttgctgccttacaac
cctaagtataagcttgctctagcagataacgtgccatacaatgtggttgatagccaaaac
cttaagaatgaacttttgactaatgcgaagaaaataccggatggaacaagaaaaccgttt
actggccaaaagaaaagccctccttggctaaataaagaaaagtatgatgcatatgaaata
gaggggaaggtaaaggcgaaggggaaagttaaagatgtaagccgtagagtgtatactatg
aaagatattgatattaatcaaaaaacagaattcggtgttacaaatcttcagctaatgaaa
aacgggaatgccccttatgcaaaagacggtacacagattaatttacatcacttgattcaa
gaagaacctggcccaatgcttgaaatcccgaacagcttacatacaaaatatagtgatgtc
attcatcagcttaagtctgatggtgaaagttttagaaatgataaggttttaaaagcacaa
tacgagagctttagaaagagatattggaaatggagagcgaaacaatttgaaaatgagaat
tga

DBGET integrated database retrieval system