KEGG   Bacillus subtilis subsp. subtilis 168: BSU19010
Entry
BSU19010          CDS       T00010                                 

Gene name
yobM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SMI1_KNR4 SUKH_6 RAG1
Other DBs
NCBI-GeneID: 939634
NCBI-ProteinID: NP_389782
Pasteur: BG13505
BSORF: BG13505
UniProt: O34377
Position
complement(2073658..2074221)
AA seq 187 aa
MYVTNFVHKTVNGLKSLLDEKGAIKLFCSEGDIMEFLVTFSQDKATLNDIQSFEAKHQLT
LPQDYQKFMTLHNGAKIFEILSDGENIGGGLQLFSLEEIEEELKYEDLFEDINGIPIGYL
LEECHLMIDKDKVNQGDPNYLYIFESGLEYNPLNLNFEKFLDRYILANGEPFWDWRYYTA
ENYYRTR
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtatgtgactaactttgttcataagactgtaaatggcttgaaaagtcttttagacgaa
aaaggagccattaaattgttttgttcagaaggtgatatcatggagttccttgttactttt
tcacaggacaaagcaaccctgaatgacattcaaagctttgaggctaaacaccagcttacc
cttccacaggattatcagaagttcatgacactacataacggtgcgaaaatttttgagatt
ctttctgatggggagaatataggtggaggacttcagctatttagccttgaagagattgaa
gaggagttaaaatatgaagatttgtttgaagatatcaatggtattccaattggctactta
ttggaagaatgccatttaatgatcgataaagataaagtgaaccaaggtgatcccaactat
ctctatatatttgaaagtggtttagaatataatccattaaatttaaactttgaaaaattt
ttagaccggtatatattggccaatggggaacctttttgggattggcgctactataccgca
gaaaattattatagaacaagatag

DBGET integrated database retrieval system