KEGG   Bacillus subtilis subsp. subtilis 168: BSU19020
Entry
BSU19020          CDS       T00010                                 

Gene name
yobN
Definition
(RefSeq) amine oxidase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8
Other DBs
NCBI-GeneID: 939632
NCBI-ProteinID: NP_389783
Pasteur: BG13506
BSORF: BG13506
UniProt: O34363 A0A6M3ZGW9
Position
2074439..2075779
AA seq 446 aa
MSGLVSASLLKNAGHRVTILEASGRAGGRVCTLRSPFSDDLYFNAGPMRIPNNHSLTLEY
IKKFKLPTNVFINRTPMDIIYANGIKTRLQVFERAPGILRYPVAPNEQGKTSEELMLSLL
QPILNFINQNPARNWRIVEEQYKNHSLSSFLNTYFSYGAIDMIGVLLDMEAYMGMSLVEV
LRESIFFSSPAHFYEITGGMDLLPHAFLPQLKTNILYHQKMMKMSQGENRVTIHCQHQQT
AEFTSFTADLAIVTIPFSTLRFVKVEPYHSFSYYKRRAIRELNYISATKIGIEFKSRFWE
KAGQHGGKSITDLPIRFSYYPSRNIGANGHAVILASYTWADEALIWDSLSEGERIQYTLL
NLSEIYGDIVWSEFVSGTSFSWSQYPYSAGGFTAFEPGQELELYPYIPVPEGRVHFAGEH
ASLTHAWMQGAIESGIRVAYEVNRLP
NT seq 1341 nt   +upstreamnt  +downstreamnt
ttgtccgggcttgtatcagcatctttgttgaaaaatgccggtcacagagtaacgattctc
gaagcgagcggcagagcgggcggccgtgtctgcactttgagatctccctttagtgatgat
ttgtatttcaacgctggcccgatgcgcataccgaataaccattcgttaaccttagaatat
atcaaaaaattcaaattgccaacaaatgtatttatcaacagaaccccgatggacatcatt
tatgcaaatggaatcaaaacacgtctccaagtttttgaacgagctcctggaatattgaga
tatccagttgcaccaaatgaacaagggaaaacgtctgaagagctgatgctttctttactg
cagcctattctaaattttatcaatcaaaatccagcaagaaattggcggattgtcgaagaa
caatacaaaaatcattcgttaagctcttttttaaacacgtatttttcatatggcgcgatc
gatatgatcggtgtacttttggatatggaagcgtatatggggatgtcccttgttgaagta
ttgcgggaatctatctttttttcatcccccgctcacttctatgagataactggcggtatg
gatctgctgcctcacgcgtttcttcctcaattaaaaacaaacattctataccatcaaaaa
atgatgaaaatgtctcagggtgaaaatcgtgttacgatccattgtcagcatcaacaaacg
gcagaattcacatcattcacagctgatctcgctattgtaaccattcctttttcaacattg
cgatttgtaaaagtcgaaccataccattcattctcttactataaacggagggccatccgt
gagctaaactatatcagtgcaacaaaaatcggcatagagtttaaaagccgattttgggaa
aaagccggtcagcacggcggcaaatctattactgatcttccgattcgtttttcatattat
ccaagcagaaatattggagcaaatggacatgctgtcattctggccagctatacatgggcc
gatgaggcactgatatgggacagtctttcagaaggagagcgaatccagtatactttactg
aatttatctgaaatctatggtgatattgtgtggtctgaatttgtgtctggcacttctttt
agctggagccagtacccgtattctgcgggaggttttacagctttcgaaccaggacaagaa
ttagagctgtatccctatattcctgtccctgagggcagagttcatttcgccggagaacac
gcctcactcactcatgcgtggatgcaaggcgcgattgaatctggaatacgtgttgcttat
gaggtcaatcgcttaccttag

DBGET integrated database retrieval system