KEGG   Bacillus subtilis subsp. subtilis 168: BSU19030
Entry
BSU19030          CDS       T00010                                 

Gene name
yobO
Definition
(RefSeq) phage-related protein YobO
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_G2 Pectate_lyase_3 Beta_helix
Other DBs
NCBI-GeneID: 939627
NCBI-ProteinID: NP_389784
Pasteur: BG13507
BSORF: BG13507
UniProt: O34433
Position
2076206..2078626
AA seq 806 aa
MVHFKNCPDPSLNANSQSHPEFSSELEHIKTRMQNFIKHSVTDQNIEVTDARVTAEGEVT
SLLKERLDKEYYRLLSKITREVNVADFGAVPDGRDNTEAFRKAIGNGRVKVHVPAGEYLV
QGIKLPSWTTIVGQGKGITVIKLHEDTPAHEWVITNDDYQNGNRNIFVQGMSLDWNPSRQ
CGVRNPGGQFSSCLTFAKVEYGWIKDVEAINAGLHGIDITSPTYDHLPDTDWTKDGSRYI
WIDNCVTYGSGDDGITTHYSEYIFISNCHSGNPRGTEFAEGVSNSNGIEIDDGSRHVWLL
NNFTSGNIRGVEVKAHELWPASQNVHIIGHISYRDVRAFDLRHIGHHQITDPESTTAYDV
TLIDCSAVEPVFNSLYDAVTPRALVISAYKNVNVSGFTAIGDPDYDYKENPVVALQYRSQ
NITINGIKIRGFKKAGVDINLSGGSNKTDYIKISNFDIYKSAPKGISIGGGLYNVNILNG
TMITDNGTVAIQSPNNQATILGVQSEGYSVAASIKGQTYQQVPINLKGGIQLATTSGFAV
NQTSAVIAGTGDITARGERNAVISSSGGSSTEGSRALIASSNNAHIRGNQASRTILSSEN
IILEEPYTVAGGHQSIKWLLDSVRGNGTFAGAISSSLGGYGEYFESSTGQLIHTGTIVTL
RGEKIVPANVGDYMLGVISETSAFISGASSFVWQGRYLTNEFGGFIYETVTDEESGELIR
VPKQNPDYDTALEANYHSRAARDEWHVVGLVGQHYVRIDETVNQGDYLTAHNGIGTKATE
GSWKVMKITSAYTSEKGYGIALTVIK
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggttcattttaaaaactgccctgatccttctctaaacgccaattctcagtctcacccc
gaattttcatccgaattagaacatattaagacaagaatgcaaaactttattaagcactcg
gttacagaccaaaatatcgaagttactgacgcaagggtgacggccgaaggagaggtcacc
tctcttttaaaagaacgtctcgacaaggaatattataggcttttatctaaaatcacccgg
gaagtaaatgtggctgacttcggcgctgttccagatggaagagacaatactgaagctttt
cgaaaagcaatcgggaatggccgagtcaaagtacatgttccagcgggagaatacctcgtt
caagggattaaacttccatcttggacaacaattgttggacaaggtaaagggatcacagtg
attaaattgcatgaagacactccagcgcatgaatgggtgattacaaatgatgattatcaa
aatggaaatcgcaatatttttgtccaaggaatgtcattagactggaatccaagtagacaa
tgcggtgtgagaaatccagggggacagttctccagttgtttaacttttgctaaggttgaa
tatgggtggatcaaagatgtggaagcgattaacgcaggtcttcatggtattgatattaca
tcgccaacgtatgaccatttgcctgataccgattggacaaaagacggatcaagatatatt
tggatcgataactgtgtgacatatggttcaggagacgacggcattaccacccattatagc
gaatacatctttatttcaaactgccattcaggaaatccgcggggaacagaatttgctgaa
ggtgtttcaaactccaacggaatagaaattgacgacggctctaggcatgtgtggcttttg
aataactttacaagcggcaacatccgcggagttgaagtaaaagcccatgaactgtggcca
gcctctcaaaacgtccatatcataggccatatttcttatcgcgatgttcgtgcatttgat
cttcgtcatattggtcaccatcaaattacagatcctgaaagcacaacagcatacgatgtc
acactcattgattgttcagcagttgaaccagttttcaactcgctttacgatgctgtgacc
ccaagagcgctggttatttcggcatataaaaacgttaatgtaagcggattcacagcgatt
ggtgatccagactatgattataaagaaaaccctgtcgtagccttgcaatatcgcagccaa
aatataaccattaatggtattaaaattcgcggttttaaaaaagccggtgttgatattaat
ttatcaggcggatcaaataaaactgattatattaaaatttcaaattttgatatttataaa
tctgctccaaaaggaatttcaatcggtggaggcctctacaatgtcaatattctaaatgga
acgatgattactgacaatgggacagttgcaattcagtcccccaataatcaggccacaatt
ctcggtgtacaatcagaaggttatagtgtggcagcctcaatcaaaggccaaacataccaa
caagttccaatcaatttgaaaggaggcatacagcttgcaacgacctctggctttgccgtt
aaccaaacaagcgcagttatagcaggtaccggcgacattacggcccgcggagaaagaaat
gcggtcattagctcttctggaggctccagtactgaaggctctcgcgcattaatcgcttct
tcaaataacgcacatattagaggaaaccaagcgtcaagaacaatactgtcttctgaaaat
attatacttgaggaaccatacaccgtggcaggaggtcatcaatcaataaagtggcttctt
gactctgttcggggaaacgggacgtttgccggtgcaatcagttcttctttaggtggatat
ggagagtattttgagagttcaactggacagttaatccatactggtacaatcgtgacttta
agaggtgaaaaaattgtgcccgcgaatgttggagattatatgcttggcgttatttcagaa
acttcagctttcatttcaggagcctccagtttcgtctggcagggccgttatttgacaaat
gagttcggcggatttatttatgaaacggtgactgatgaggaaagcggtgaactcatacgt
gttcccaaacaaaatccagactacgatacagcgctggaggcaaattatcattcacgggca
gcaagagacgaatggcacgttgtagggttggttggccaacattatgtgcgtattgacgaa
actgtcaatcaaggagattatcttacggcacataatggaataggaacaaaagccactgaa
ggaagctggaaagtaatgaaaataacctctgcttacacatcagaaaaagggtatggtatc
gctctaaccgtcatcaaatag

DBGET integrated database retrieval system