KEGG   Bacillus subtilis subsp. subtilis 168: BSU19040
Entry
BSU19040          CDS       T00010                                 

Gene name
csaA
Definition
(RefSeq) protein CsaA
  KO
K06878  tRNA-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU19040 (csaA)
SSDB
Motif
Pfam: tRNA_bind
Other DBs
NCBI-GeneID: 939631
NCBI-ProteinID: NP_389785
Pasteur: BG10809
BSORF: BG10809
UniProt: P37584
Structure
PDB: 
2NZH 2NZO

Position
complement(2079214..2079546)
AA seq 110 aa
MAVIDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLI
NKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKIG
NT seq 333 nt   +upstreamnt  +downstreamnt
atggcagttattgatgactttgagaaattggatatcagaacgggaacaattgtaaaagcg
gaagaatttcctgaagcaagagtaccggcaatcaagcttgtgatagattttgggactgaa
atcggcataaaacaatcgagcgcacaaatcacgaagcgttacaagccggaaggtctcatc
aacaagcaagtcatagcagtcgtgaactttccgccccgccggatcgccggatttaaatcg
gaagtcttggtcctcggcggcatacccggccagggcgacgtcgtccttttgcagccggat
cagcctgtcccaaacggcacaaaaatcggataa

DBGET integrated database retrieval system