KEGG   Bacillus subtilis subsp. subtilis 168: BSU19050
Entry
BSU19050          CDS       T00010                                 

Gene name
yobQ
Definition
(RefSeq) AraC family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_18 HTH_AraC Cupin_2 AraC_binding AraC_binding_2
Other DBs
NCBI-GeneID: 939637
NCBI-ProteinID: NP_389786
Pasteur: BG13508
BSORF: BG13508
UniProt: O34901
Position
complement(2079611..2080336)
AA seq 241 aa
MLMDSLQEIICEKRTYTRLYHSHKHAYSQFLFPLEGSIDLETEGRQVKLNPDHFLYIPPQ
CEHRFRSIGRNECLVLDVPLHAMKIDEYRAGSGIEAALDPFWSSIRYLLTEEAKAGTANS
LHMLVQYIKEKLQSHSYASIAYIHSHLFERLTIKKLAEIEHYHPAYYSSWFKKQTGKSPQ
NYIADLRLEEAKRMLMERNETLTVVSEALGFQNLSSFTRWFTKSTGMPPRLYRNTLYSDK
K
NT seq 726 nt   +upstreamnt  +downstreamnt
ttgctaatggactcgcttcaagagataatttgcgaaaaacggacatacacacggctatat
cattcacataagcacgcgtacagccaatttctttttccgcttgaagggagtattgatctt
gagactgaggggcgccaggtgaaattaaatccggatcattttttatatattccgccgcag
tgcgagcatcgcttccgttctatcggaagaaatgaatgtcttgtactggatgttccgctt
catgcaatgaaaattgatgagtatcgtgcaggatcaggaattgaagctgccctcgatcct
ttctggtcttcgatcaggtacttgctgacagaggaagcaaaggccggaacagccaactcg
cttcatatgctagtacaatacataaaagaaaagcttcaatcccatagctatgcctcaatt
gcatacattcacagccatttatttgagcggctgacgattaagaagctggcagaaatcgag
cattatcacccagcttactattcaagctggttcaaaaaacagacagggaagtccccgcag
aactatattgccgaccttcgccttgaggaagcaaaaagaatgctgatggagagaaatgaa
actcttaccgtcgtgagcgaggcgctgggctttcaaaacctttcttcttttacaagatgg
ttcacgaaaagcacaggaatgccgccccgcctgtatcgaaacaccttatattcggataaa
aaatga

DBGET integrated database retrieval system