KEGG   Bacillus subtilis subsp. subtilis 168: BSU19060
Entry
BSU19060          CDS       T00010                                 

Gene name
yobR
Definition
(RefSeq) acetyltransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 FR47 Acetyltransf_10 Acetyltransf_3 Acetyltransf_4 Acetyltransf_8 Acetyltransf_9 Acetyltransf_CG
Other DBs
NCBI-GeneID: 939650
NCBI-ProteinID: NP_389787
Pasteur: BG13509
BSORF: BG13509
UniProt: O34376
Position
complement(2080351..2081094)
AA seq 247 aa
MDDIRKIERLAAASWPAYFQKSIGKWLLRANFGVTKRANSVWTSADMPEGDFQLEAELFY
QSLGLPVCFHISNASPKGLDDALADSRYEKVDECFQMTALCRSIMSRTNDNSRFTYKWEQ
EPSSVWIDEFIQLEGFSPERHKGYKHIFERMPPCKTFFKMYDKESLTALGTVSVIDGYGG
LSNIVVAEEHRGKGAGTQVIRVLTEWAKNNGAERMFLQVMKENLAAVSLYGKIGFSPISE
HHYRIKR
NT seq 744 nt   +upstreamnt  +downstreamnt
atggatgacattcgcaagattgaacgattagcggcagcttcatggccggcttattttcaa
aaaagcatagggaaatggcttctcagagcgaattttggcgtaaccaaaagggcaaatagc
gtatggacgtctgcggatatgcctgaaggggattttcagctagaggccgaacttttttat
caaagtttaggcttacctgtttgttttcatattagcaacgcatcaccgaaagggcttgat
gacgcattggcagacagccgttatgaaaaggtagacgagtgcttccagatgacagcgttg
tgccggtcaattatgagccgaacaaatgacaacagccgatttacatacaagtgggaacaa
gagccatcatctgtttggatagatgaatttattcaattagaagggttttcacccgagcgt
cacaaaggttacaaacacatattcgaacgcatgccgccgtgtaaaacttttttcaagatg
tatgacaaagaaagcctgacagcgcttggcacggtttctgtcattgatggttatggcgga
cttagtaatatcgttgtagctgaggagcacagaggaaaaggggcaggaacccaagtgatc
agggtgttgactgaatgggcaaaaaacaacggagcggaacgcatgtttttacaagtgatg
aaagaaaatctggcggcagtttctttatatggaaaaatcggcttttcgcctatatcggaa
caccattaccggattaaaagatga

DBGET integrated database retrieval system