KEGG   Bacillus subtilis subsp. subtilis 168: BSU19070
Entry
BSU19070          CDS       T00010                                 

Gene name
yobS
Definition
(RefSeq) TetR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TetR_C_33 TetR_N
Other DBs
NCBI-GeneID: 939639
NCBI-ProteinID: NP_389788
Pasteur: BG13510
BSORF: BG13510
UniProt: O34892
Position
complement(2081172..2081747)
AA seq 191 aa
MSPRIGLTQKMIVDAAAEIADQEGVNGVSLAALSKKMNVRPPSLYNHINGLQAIRAELAV
RGLTKLFDQMADSVTERKGDSAMLSLAHAYVDFAIENPGYYEAALLKVHDKRTEIVSDQI
VCLVTKLLIENGYASEKTAIHATRGLRSLLHGFTVLIAKEAFEREEDILESLSFSIRTFL
SGLLINNKNIM
NT seq 576 nt   +upstreamnt  +downstreamnt
atgtcaccgagaataggtttgacccaaaaaatgattgtagacgctgcagcagagattgcc
gatcaggaaggggtaaatggtgtctcacttgctgcactttctaaaaaaatgaatgttcgc
cccccgtcattgtataaccatatcaacgggctgcaagcgatcagagcagaacttgctgtc
agaggactgacaaagctttttgatcaaatggcggactccgtaaccgaacgaaagggagat
tccgcgatgctttctttagctcatgcatatgttgattttgcaattgaaaatcccggatat
tatgaagcggctcttcttaaggttcacgacaaacggacggaaatcgtctctgaccaaatt
gtctgtcttgtgacgaagctgctcattgaaaacggctatgcaagtgaaaagactgccatt
catgcgacaagggggctcagaagtctgctgcatggctttactgttttaatcgcaaaagaa
gcatttgaacgtgaggaggacattttagaaagcctgtcattttcaattcggacatttttg
tcaggattattaataaacaataaaaatattatgtaa

DBGET integrated database retrieval system