KEGG   Bacillus subtilis subsp. subtilis 168: BSU19080
Entry
BSU19080          CDS       T00010                                 

Gene name
yobT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2 Lactamase_B_6 DUF498 Sulfotransfer_3 Lactamase_B_3
Other DBs
NCBI-GeneID: 939645
NCBI-ProteinID: NP_389789
Pasteur: BG13511
BSORF: BG13511
UniProt: O34910
Position
complement(2081753..2082454)
AA seq 233 aa
MRITQYQTVWQLTFFPALFPVNCYLVEEENEVTLIDAALPGSYKGIIQAVNQLGKPLQHI
LLTHAHGDHVGSLDTLAQTFPHAKVMISERDSFLLQGDTSLRQDEPQTPIKGGIPKHIQT
KPHQLLTGGETIGSLLAIPTPGHTPGSMSFLDTRNGTLIAGDAFQLRGGIAVSGQIKWAF
PFPAFATWNKEEAIKSAQLLADKAPSCLAVGHGKFLRSPSERMRQAIQKAKKG
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagaattactcagtaccaaacggtttggcagctgactttttttccagcattgtttccg
gttaattgctatttagtagaggaagaaaacgaagtcacccttattgatgccgcactgcca
ggcagctataaagggattattcaagctgtgaatcagcttggaaaaccgcttcagcatatt
ttactgactcatgcacatggggaccatgtcggatcactggatacattggcacaaacattt
ccgcatgcaaaggtcatgatctcggaacgggattcattcttgctccaaggtgacacatct
ttgcggcaagatgagccgcagacgcctataaaaggaggtattccgaaacacatacaaaca
aagcctcaccaactgctgacgggcggtgaaacaattggttctctgcttgccattccaaca
ccgggccatacaccgggcagcatgtcatttcttgatacaagaaacggcactttaatagca
ggagatgcgtttcagttgcgcggaggaatcgctgtatcaggtcagataaaatgggcgttt
ccttttcccgctttcgccacatggaataaggaggaggccatcaaaagtgcacaattgctc
gccgataaggcgccttcctgtctcgctgtcggacatggaaaattcctgcgatcaccttca
gagcggatgagacaggcgatccaaaaagcaaagaaaggatga

DBGET integrated database retrieval system