KEGG   Bacillus subtilis subsp. subtilis 168: BSU19090
Entry
BSU19090          CDS       T00010                                 

Gene name
yobU
Definition
(RefSeq) transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GyrI-like Cass2
Other DBs
NCBI-GeneID: 939647
NCBI-ProteinID: NP_389790
Pasteur: BG13512
BSORF: BG13512
UniProt: O34637
Position
complement(2082531..2083013)
AA seq 160 aa
MGFSHITHLDLKRFAGLSQRTSNALEMTEERRIPALWDQLWKQDMSALLSQAEKDKSIIA
LYSNYEQETNGFYTFSVGTFQEYDDILPGPYENIDLPASAYAVFTSRIGPIEEIVLETWK
EIWTWDKRHLRTFTGDFEMYDQNAAVPQRAQVNIYVAIKK
NT seq 483 nt   +upstreamnt  +downstreamnt
atgggcttttcacatataacacacttagacctgaaacgatttgccggactatcacaacgg
acaagcaacgcactggaaatgacggaagaaaggaggattccggcactgtgggatcaatta
tggaagcaggatatgagcgctcttttatcacaggctgaaaaagacaagagcattattgcc
ttatattcgaattatgaacaagagacgaatgggttttatacgttttcagtcggaacgttt
caggaatacgacgacattcttccgggaccatatgaaaatattgatttgccggcttccgct
tacgccgttttcacttccagaatcggtcctattgaagagattgtgcttgaaacgtggaag
gaaatttggacttgggataagcggcatctgcgcacgtttacaggtgactttgagatgtat
gatcaaaatgccgcagtgccacagcgagcacaagttaacatttatgtagcgataaaaaaa
taa

DBGET integrated database retrieval system