KEGG   Bacillus subtilis subsp. subtilis 168: BSU19100
Entry
BSU19100          CDS       T00010                                 

Gene name
yobV
Definition
(RefSeq) DeoR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: WYL HTH_11 HTH_PafC HTH_DeoR Mga HTH_29 Phage_Nu1 HTH_7 Rrf2 PuR_N
Other DBs
NCBI-GeneID: 939644
NCBI-ProteinID: NP_389791
Pasteur: BG13513
BSORF: BG13513
UniProt: O34920
Position
complement(2083067..2084008)
AA seq 313 aa
MKLERLLAMVVLLISKKQVQAAELAELFEVSVRTIYRDIETINRAGIPIVTSQGSGGGIG
IMETYRLEREWLKEEELFAIASALQSVSSMYEPVSHSTAYQKIKHLIPEQSTQAFKHQTE
KWFIDMTAWGHTEDQKTLREKISAAIDRLLTISFTYTSASGETLLRETEPYTLVCKAGHW
YLYAYCLVRNDFRFFKLNRMKDLAILHQTFIRKDIQLDTLPWDKSWYQKDRLTELVILVQ
PSARQRIGEWFGYDVLHCCEEDEICQAVISLPEDQWLIGFLLQFGKDIEVLQPLHIRDKV
KETIHHMQKIYET
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaaactggaacgtttgttagcgatggttgtgttattgatcagcaaaaaacaagtgcag
gctgcagagcttgctgagctgtttgaagtatctgtcagaacaatttaccgtgatattgag
acgatcaatagggctggtattccgattgtgacctcacagggttccgggggcggaattggc
atcatggaaacgtatcggcttgaaagagagtggctgaaggaggaggaattgtttgcaatt
gcttccgctttgcaaagcgtttcatctatgtatgaacccgtttctcacagcacagcctat
caaaaaatcaaacaccttatacctgagcaatctactcaagcatttaagcaccaaacagaa
aaatggtttattgacatgacggcttggggccatactgaggatcaaaagacgctgcgcgag
aaaatcagcgctgccatcgatcggttgttaacgatatcttttacatatacaagcgcaagc
ggggaaacactacttcgggaaactgaaccttatacattggtttgcaaggcggggcactgg
tatttatatgcctactgcctggtaagaaatgattttcgcttttttaaactgaaccggatg
aaagatctggccatcttacatcagacatttatcagaaaagacattcagctggacactttg
ccatgggataagagttggtaccaaaaggaccgtttaactgaattggttattcttgttcag
ccgtcagcacgtcagcgtataggtgaatggttcggatatgatgtccttcactgttgtgag
gaagatgaaatctgccaggcggtgatttcacttccagaagatcaatggctgatcggtttt
ttgctccagttcggaaaggatattgaggttctgcagcctcttcatataagggataaagta
aaagaaaccattcatcacatgcaaaaaatatatgaaacctga

DBGET integrated database retrieval system