KEGG   Bacillus subtilis subsp. subtilis 168: BSU19110
Entry
BSU19110          CDS       T00010                                 

Gene name
yobW
Definition
(RefSeq) mother cell-specific membrane sporulation protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Voltage_CLC DUF1453 DUF5373
Other DBs
NCBI-GeneID: 939656
NCBI-ProteinID: NP_389792
Pasteur: BG12269
BSORF: BG12269
UniProt: P94497
Position
2084214..2084759
AA seq 181 aa
MHLTLQSVYPAIIIIFFLYKKIKRSIGYQPLKPRWLFTRIILFSLFAFGLSIFSAIHPFL
YGYLILGILGGWLLVFFAKKNISFEKRRGKIYFRTHIWVEVILLTLFLSRFLYRVTELYL
TSPDLNRLGSYSQSIGTDPLTIGVCFLIAVYYIGFSSFIIKLSRNELEQHEYNKEKDILA
R
NT seq 546 nt   +upstreamnt  +downstreamnt
atgcatcttacacttcagagcgtttatcctgccataatcatcatcttttttctgtataaa
aaaattaaaaggtccatcggataccagccgctgaagccccgctggctgttcacccgtatc
attcttttctcgctgtttgcttttggactttcaatcttcagcgccattcaccctttttta
tatggatatctcattttgggcattcttggcggatggctccttgtctttttcgctaagaaa
aacatctcttttgaaaaacgcagaggaaagatctattttcggactcatatttgggtagag
gtgattctcttaactttatttctatcaagatttctgtatcgagtgacggagctttatctt
acctcacctgatctaaaccgccttggatcatacagtcagtcaatcggaacggaccctctg
acaattggcgtctgttttctgatagccgtttattatatcggtttttcttcttttatcatc
aagctcagcagaaacgaacttgaacagcacgaatacaataaagaaaaagacatccttgcc
cgctaa

DBGET integrated database retrieval system