KEGG   Bacillus subtilis subsp. subtilis 168: BSU19120
Entry
BSU19120          CDS       T00010                                 

Gene name
czrA
Definition
(RefSeq) ArsR family transcriptional regulator
  KO
K22043  ArsR family transcriptional regulator, zinc-responsive transcriptional repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU19120 (czrA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   ArsR family
    BSU19120 (czrA)
SSDB
Motif
Pfam: HTH_5 HTH_20 TFIIE_alpha TrmB HTH_24 MarR MarR_2 DUF4423 HTH_38 Arg_repressor MerR_1 HTH_IclR HTH_23 Rrf2 HrcA_DNA-bdg HTH_27 GerE HTH_1
Other DBs
NCBI-GeneID: 939658
NCBI-ProteinID: NP_389793
Pasteur: BG13748
BSORF: BG13748
UniProt: O31844 A0A6M3ZBV8
Position
complement(2084786..2085109)
AA seq 107 aa
MTEFRETEQSAADLDEETLFLVAQTFKALSDPTRIRILHLLSQGEHAVNGIAEKLNLLQS
TVSHQLRFLKNLRLVKSRREGTSIYYSPEDEHVLDVLQQMIHHTQHD
NT seq 324 nt   +upstreamnt  +downstreamnt
atgactgaatttagagaaacggaacaatcggctgctgatctggacgaggagacgctgttt
ctagtcgcgcaaacattcaaagcgctttcagatcctacccgaatcagaattctccattta
ttgtcccaaggtgagcatgcagtaaacggaattgcagaaaagctgaatttactgcaatcc
actgtgtcccaccagcttagatttttaaaaaatctccggcttgtcaaatcgcgcagagaa
ggaacatcgatttattactctccggaggatgaacatgttttagatgttcttcagcaaatg
atccatcatacacagcatgattga

DBGET integrated database retrieval system