KEGG   Bacillus subtilis subsp. subtilis 168: BSU19130
Entry
BSU19130          CDS       T00010                                 

Gene name
yocA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lysozyme_like SLT Ac110_PIF
Other DBs
NCBI-GeneID: 939661
NCBI-ProteinID: NP_389794
Pasteur: BG13514
BSORF: BG13514
UniProt: O34636
Position
2085303..2085980
AA seq 225 aa
MKKKRKGCFAAAGFMMIFVFVIASFLLVLLFFNRDLIKKLPIDTKTIVLERLTDYKPLVE
EELESQGLSNYTSLILGMMYQESKGKGNDPMQSSESLGLKRNEITDPQLSVKQGIKQFTL
MYKTGKEKGVDLDTIIQSYNMGAGYIDFVAEHGGTHTEELAKQYSEQQVKKNPDLYTCGG
NAKNFRYPYCYGDYTYAEKVKEKTKTVEESLQVATLETMESKAHE
NT seq 678 nt   +upstreamnt  +downstreamnt
gtgaagaaaaagagaaaaggctgtttcgctgctgcgggttttatgatgatttttgtcttt
gtcatcgcctcttttttattggtcctgctttttttcaaccgggatttaatcaaaaaactt
ccgatcgatacgaaaacgattgttttggaacgtttaaccgattacaaacccttggtggaa
gaagagcttgaaagccaaggactctctaattatacatcactcatattaggcatgatgtat
caggagtcaaaaggaaaaggcaatgatcccatgcagtcctctgaatctctggggttaaaa
cgcaatgagataacagaccctcaactcagtgttaaacaaggcatcaagcaatttaccctc
atgtacaagaccggtaaggaaaaaggcgtggatttggataccattattcaaagctacaac
atgggggcaggttacattgattttgtagctgaacatggaggaacgcatactgaggaattg
gcaaaacaatactccgagcagcaagtcaaaaaaaatcctgatctgtatacttgcggggga
aatgcgaaaaatttccgctatccgtattgctacggtgattatacgtatgcagaaaaagta
aaagaaaaaacaaaaactgttgaagaatctttgcaggttgcaacacttgaaaccatggaa
tccaaggctcatgaataa

DBGET integrated database retrieval system