KEGG   Bacillus subtilis subsp. subtilis 168: BSU19140
Entry
BSU19140          CDS       T00010                                 

Gene name
yozB
Definition
(RefSeq) hypothetical protein
  KO
K08976  putative membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU19140 (yozB)
SSDB
Motif
Pfam: DUF420 DUF2306 DUF5357
Other DBs
NCBI-GeneID: 939655
NCBI-ProteinID: NP_389795
Pasteur: BG13749
BSORF: BG13749
UniProt: O31845
Position
complement(2086070..2086606)
AA seq 178 aa
MNQTENKPKNYTGIVLTLTVLINGLIAVLFFMPKLDQFSHANIHILPMLNAIFNSFTFIF
LLAALIMIKQKNIKAHKRFILAAFTTTLLFLICYVTYHSIAENTLYGGEGIMRPIYFFIL
ITHICLSAIIVPLALFTLIRGFSMQVERHKKIARWTMPLWLYVSLTGVIVYLMISPYY
NT seq 537 nt   +upstreamnt  +downstreamnt
atgaaccaaacagaaaataaaccgaaaaattacacggggattgtccttacgctgacagtt
ctgattaacggtttaatcgcagtgctgttttttatgcctaaattagatcagttcagccat
gcgaatattcacattttgccaatgctgaatgcgatattcaatagctttacgtttatcttc
ttattggccgcgctgattatgattaaacagaaaaatatcaaagctcacaaacgctttatt
ttggctgcgttcacaacaacattactatttttgatttgctatgtgacgtaccactcgatt
gcggaaaacacgctctatggcggagaaggtattatgcgcccgatttatttctttatttta
attacacatatctgcctttctgcaattattgtgccgcttgcgctgtttacgctgatcaga
ggcttcagcatgcaggtggagcgccataaaaaaattgcgagatggacaatgcctctatgg
ctgtatgtaagccttacaggcgttattgtatatttgatgatttcaccgtattattaa

DBGET integrated database retrieval system