KEGG   Bacillus subtilis subsp. subtilis 168: BSU19150
Entry
BSU19150          CDS       T00010                                 

Gene name
yocB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: baeRF_family5 baeRF_family10 baeRF_family12 Host_attach baeRF_family2
Other DBs
NCBI-GeneID: 939442
NCBI-ProteinID: NP_389796
Pasteur: BG13515
BSORF: BG13515
UniProt: O34516
Position
complement(2086743..2087525)
AA seq 260 aa
MAIDSLINKLQYVQLEPPDKILSLYLNTDMRDPEQQGGEWKIALKSGFSRLKEYLAASDP
EEEKCLDGIRAKMNQYLNAMGKDMPRSLVFFVSDSGIWEPIKLQVPVDTRFYWEETAVLD
QLKGLRQTYPSTAFILTQQHEVKIIETVLGKIEAVERYEYDMINESWKNSHSAVDKAPPF
EENRMREHVTENQSRLYKRLAASLDQKAAAKRWERMVIAGDKETADILDQHMNKPIHSKI
QKNLLNENEHKVIEHLIKEA
NT seq 783 nt   +upstreamnt  +downstreamnt
atggcgattgattcattgattaacaaattacagtatgtccaattggaaccgccggataaa
attctctctctgtatctcaatacagacatgagagatccagagcagcaggggggagaatgg
aagattgccctaaagtcaggattcagccgattaaaagagtatttggcagctagtgatcca
gaggaggaaaagtgtctggatggaatcagggctaaaatgaatcaatacttgaatgcaatg
ggaaaagacatgccccgcagtctcgtgttttttgtttccgacagcggcatatgggaacct
attaagcttcaagtccctgtagatacaagattttactgggaagaaacagctgtcctggat
cagctaaagggtttgcgccagacatacccaagtacggcgtttattttaactcagcagcat
gaagtgaaaattattgaaactgttttaggaaaaattgaggcggtggagcgttatgagtat
gatatgatcaatgagtcttggaagaatagccattccgctgtagacaaagcgccaccattt
gaagagaaccggatgagggaacatgtaacagagaaccaatcgagactgtataagcggctg
gctgccagccttgatcaaaaagctgccgcgaaaagatgggaacgaatggttattgccggg
gataaagaaacggccgatatcttggatcagcatatgaataaacccattcattcgaaaatt
caaaagaacctgctgaatgaaaatgaacataaggtcattgaacatttgataaaagaggcg
taa

DBGET integrated database retrieval system