KEGG   Bacillus subtilis subsp. subtilis 168: BSU19160
Entry
BSU19160          CDS       T00010                                 

Gene name
yocC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Bacillus_HBL FlaC_arch NuA4
Other DBs
NCBI-GeneID: 939666
NCBI-ProteinID: NP_389797
Pasteur: BG13516
BSORF: BG13516
UniProt: O35042
Position
2087696..2088193
AA seq 165 aa
MFTVKEKNRQELEEELNDLEFQIYRMQENMKDLSKDAKVLGIDQSKHDEWMIVSSIDDGQ
TCKIMLTDCKTAYRGKGCFSLVASYKDDAIHIGDIKGPPNHGFGSICMKYLKDIARDHNI
PKVTGDIAKRDWNHVDRLIHFYEKHHFKVCIDHDTQSGSIKWVDL
NT seq 498 nt   +upstreamnt  +downstreamnt
ttgtttactgttaaagaaaaaaatcgtcaagagcttgaggaagaactaaatgatttagaa
tttcaaatttatcgcatgcaggagaatatgaaggatttatctaaagatgccaaagtgctt
ggtattgatcaatcgaaacatgatgagtggatgattgtttcctcgattgatgatggccaa
acatgcaaaattatgctaactgattgtaaaacggcataccgaggaaaaggctgtttttca
cttgtagcgtcttacaaggacgatgccattcatataggggatataaaaggccctccgaat
cacgggtttggctccatttgcatgaaatatttaaaagatattgcaagagaccataatata
ccgaaagtcaccggagacatcgccaaacgggattggaatcatgtagaccggctgattcac
ttttatgaaaaacatcacttcaaagtatgtatcgatcatgatacccaatccggcagcatt
aagtgggttgatttgtaa

DBGET integrated database retrieval system