KEGG   Bacillus subtilis subsp. subtilis 168: BSU19170
Entry
BSU19170          CDS       T00010                                 

Gene name
yocD
Definition
(RefSeq) carboxypeptidase YocD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_S66 Peptidase_S66C
Other DBs
NCBI-GeneID: 939659
NCBI-ProteinID: NP_389798
Pasteur: BG13517
BSORF: BG13517
UniProt: O35046
Position
2088257..2089234
AA seq 325 aa
MYASKLKKGDEIRIVSPATSMSILSNEAKIQAKTALERLGYRVTIAEHANECNEFDSSSI
ESRVHDLHAAFFDPGVKAILTTLGGFNSNQLLRYLDYEKIKRHPKILCGYSDITALCNAI
YQKTGLVTYSGPHFSTFAMKKGLDYTEEYFLSCCASDDPFEIHPSSEWSDDRWFLDQENR
RFYPNNGPVVIQEGYAEGTLIGGNLCTLNLLQGTEYFPETEHTILLIEDDYMSDIHMFDR
DLQSLIHLPAFSHVKAILIGRFQKASNVSIDLVKAMIETKKELSGIPIIANINAGHTSPI
ATFPIGGTCRIEAISGTSRIWIDKH
NT seq 978 nt   +upstreamnt  +downstreamnt
atgtacgcctcaaaactgaaaaagggagacgaaatccggatcgtgtctcccgcgaccagc
atgtctatattatcaaatgaagcaaaaatccaagcaaaaacggcgttagaacgcttaggt
tatcgggtaaccatcgctgaacacgcaaatgaatgtaacgaatttgattcatcctctatc
gagtcaagagtccatgatctgcacgctgccttttttgatccaggcgtcaaagcgatttta
acgacactcggagggtttaattcaaatcagctgctgcgttatcttgattacgagaaaatc
aaacgacatccaaaaattctgtgcggttattccgatataaccgctctttgcaacgctatt
tatcaaaaaacgggtcttgttacgtattcaggtccccacttctcaacatttgcaatgaaa
aaaggactcgattatacagaggagtattttctttcttgctgcgcttcagacgatccgttt
gaaattcacccctcaagtgagtggagcgatgatcgctggtttttggatcaagaaaacagg
cgtttttatcctaataacggccctgttgtaatccaagaaggttatgcggaaggtacttta
attggcggaaacttatgcacgcttaatttgctgcagggaacggagtattttcccgaaaca
gaacatactattttattgattgaagatgattatatgtcagacatccatatgtttgaccgc
gatctgcaatcactcatccacctccccgctttttcacatgtaaaggcgattttgatcggc
agatttcagaaagcatcaaacgtatcaatagatcttgtaaaagccatgatcgaaacaaaa
aaagaattatccggcatcccgatcatcgcaaatataaatgccggacatacctcgccaatt
gccacgttccctataggaggaacatgcaggattgaagctatttcgggtacatcacgaata
tggattgataaacattaa

DBGET integrated database retrieval system